
To feed the mind is to feed the body.

Pecan Apple Sheet Pan Pancakes

Pecan Apple Sheet Pan Pancakes

The easiest version of plant-based pancakes you've ever made.

Read article

+Read article

Easy Black Bean Burgers
blackbeanburgers&sweetpotatofriesby:complementburgersarealwayssomethingyoucangetexcitedabout.there’ssomethingabouteatingthemthatjustfeelslikeaspecialtreat.well,thisspecialtreatiscompletelyplant-basedandpackedwithhealthybean-poweredprotein.enjoywithallofyourfavoriteburgerfixingsandsomecrispybakedsweetpotatofriesontheside.ingredients: forthebakedsweetpotatofries:2mediumsweetpotatoes1toliveoilgenerouspinchofsaltandpepper1tspsmokedpaprika fortheburgers:1tbspgroundflaxseed+3tbspwater(canusegroundchiaseed)1-14.5ozcansblackbeans,drainedandrinsed1/2cupbreadcrumbs1tsponionpowder1tspgarlicpowder1tspcumin1tspchilipowder1tspsmokedpaprikagenerouspinchofsaltpinchofblackpepper1tbspsriracha(orhotsauceofchoice)1toliveoilbunburgerfixings(whateveryoulike–veganmayo,tomato,lettuce,onion,mustard,etc.) directions forthebakedsweetpotatofries:preheatovento425°f.cutthesweetpotatoesintolongstrips,tosstheminabowlwith1toliveoil,agenerouspinchofsaltandpepper,andsmokedpaprika.bakeonagreasedpanfor15min,carefullyremovethepanandtossthemaround.returntoovenforanother10minutes. fortheburgers:placeflaxandwaterinasmallbowl.setasidetothicken.placebeansinalargebowl.mashwithapotatomasherorforkuntilmostbeansarebrokenup,leavingsomewhole.addbreadcrumbs,onionpowder,garlicpowder,cumin,chilipowder,smokedpaprika,salt,pepper,sriracha,andflaxmixture.stiruntilwellcombined.forminto2-3tightlypackedpatties.youcanrefrigeratethemuntilyouarereadytocookorcookthemrightaway.warmaskilletovermediumheatwitholiveoil.cookburgersforabout6minutesperside,oruntilgoldenbrown.buildyourburgerandenjoywithasideofsweetpotatofries.makes2largeburgers,or3mediumburgers. recipeby:

Easy Black Bean Burgers

+Read article

Fiery Tofu Masala Curry
fierycoconuttofumasalacurryby:complementfieryspicescombinedwiththenaturalsweetnessofcreamycoconutmilkwillsetyourpalletablaze.enjoythisfull-flavoredcurryoversomeperfectlycookedriceorquinoaforacompleteanddeliciousmeal.tip:curryleftoversareamazing,asthespicesonlyenhanceastheysit.ingredients: 1packagefirmtofu2toliveoil1/3cchoppedcilantro3ctomatosauce(plaincanned,notseasonedwithherbs)11/2tspgarammasala(orcurrypowder)1/2tspcayennepepper1/3cfullfatcoconutmilk1tmaplesyrup1largeclovegarlic,grated1/4-1/2tspsalt1cbrownriceoranyotherwholegrainofchoice directions setoventoroastat400°f.cookyourpreferredgrain(stovetop,ricecooker,pressurecooker,orevenpre-cooked/microwavable)drainandpressthetofu,gettingoutasmuchmoistureaspossible,thencutintobite-sizecubes.inabowl,tossthetofucubeswith1toliveoilandapinchofsalt,spreadonapanandroastinovenfor15min.whilethat'sroasting,takeapanandputitovermediumheat.addin1toliveoilandthegarammasala,stirtogetheruntilfragrant(about1minute).addtomatosauce,gratedgarlic,maplesyrup,cayenne,andstirfrequentlywhilesimmeringforafewminutes.addthecoconutmilkandstiroverheatforacouplemoreminutes.removefromheatandaddsalttotaste.serveoveryourcookedgrainofchoice,garnishedwithchoppedcilantro.makes2servings.recipeby:

Fiery Tofu Masala Curry

+Read article

Plant-Based Gift Guide: 18 Last-Minute Gifts Under $60
plant-basedgiftguide:18last-minutegiftsunder$60by:doughayifyou'relookingforlast-minuteholidaygiftideasforyourselforaplant-basedlovedone,don''renottoolate.isurveyedourteam,friends,andfamiliestofind18giftsanyplant-basedeaterwilllove,allunder$60.butbeforeigettotheideas,let'sclearupabiggerquestion:whatmakesforagoodgift?that,ofcourse,dependsonwhoyouask.butforme,theperfectholidaygiftshouldbesomethingthatthey’llactuallyuse,probablywouldn’tbuyforthemselves,anddoesn’tsitaroundonacounterorclosetunusedmostoftheyear.fair?good.i’mgladweagree.withthoserulesinplace,mostgoodgiftsfallintooneofthreecategories:practical:usefulorconsumablegiftsyou'resuretolove.inspirationalormotivational:giftswhich—fortherightperson—areexactlywhattheyneedtomovethemclosertotheirgoal.nicetohaves:thoughtful,funitemswhichtheyprobablywouldn'thavepurchasedotherwise,butsoonmaybecomeoneoftheirfavorites.couldyousplitgiftsupintofurthercategories?sure.butforthesakeofthisblogpost,let'sfocusonthesethree.startingwiththepractical: practicalgiftsforplant-basedeatersranchogordobeangiftbox($34)untilyou'vehadquality,heirloombeansfromaspecialtygrower,it'shardtounderstandwhatmakesdriedbeanssuchagoodgift.butonceyoudo,you'llneverwanttogoback.ranchogordooffersgiftboxesandabeanclubsubscription,whichcomplementco-foundermattfrazierhasusedforyears,bothofwhichareperfectforanyonewhofollowsaplant-baseddiet.tradecoffeesubscription($40)subscriptionboxesofferanopportunitytoexplorenewingredients,foods,orbrandsyouwouldn'tdiscoverotherwise,butunfortunately,theycanbehitormiss.that'swhyirecommendasubscriptionboxcenteredaroundaveryspecificthing—coffeeinthiscase(orbeans,withranchogordo).trade'scoffeesubscriptionstartswithasurveytopersonalizetheirrecommendationsbasedonyourtaste,thensendsanewbagbasedonyourschedule,fromoneofover55indieroasters.i'veusedthetradecoffeesubscriptionforanumberofmonthsandlovediscoveringnewtastesandroasts.uncommongoodscollapsiblepopcornpopper($20)unfortunately,goodveganmicrowavedpopcornishardtocomeby.that'swherethissiliconerubberbowlcomesin.addpopcornkernelstothebowlwithnooil,foraneasy,mess-freepop.myfamilypullsoutourpopperweeklyforaquickafternoonsnackormovienighttreat.(protip:oncepopped,sprinklenutritionalyeastontopforaburstofflavor.) gourmetfoodswantagiftideathat’sguaranteedtobeacrowdpleaser?gourmetplant-basedfoodsthatfeelextraspecialfortherecipient.i’mtalkingaboutasingleblacktruffle($59),artisanplant-basedmeat—likethesesmokedsalami’sfromrenegadefoods($40)—orafinebottleofwine. practicalstockingstuffers complement'splantproteinbites($27)with14gofcompleteplant-basedprotein,realfoodingredients,andmouthwateringflavors,plantproteinbitesareahealthysnackyourentirefamilywilllove.sjaak'sorganicchocolate($5)whodoesn'tloveagoodchocolatebar?sjaak'susesorganic,plant-basedingredientstocreatedrool-worthychocolatebars.they'vebecomeaninstantfavoriteforourin-houseregisteredholisticnutritionist,juliamurray,whoeatsthemasatreatduringskitripsormountainbikerides. plant-basedinspirationalandmotivationalgiftideas cookbooksit'sneverabadideatogivethegiftofacookbook.theycaninspireyoutodayandkeepyouontrackforyearstocome.whetheryourlovedoneisatrainedchefornewtocookingplant-basedfoods,therightcookbookcanunlockaworldofnewflavorsandrecipes.aftersurveyingourteam,herearesomeofourfavorites:plantyoucookbook($19)—140+ridiculouslyeasy,amazinglydeliciousplant-basedandoil-freerecipes.(thisisateamfavorite,forboththeadultsandourkids.)badmannersbravenewmealcookbook($16)—badmannerswantstoteachyouhowtoshopandcooksmarter,soeatingplant-basedathomedoesn'thavetobeboring.america'stestkitchen'svegancookingfortwo($31)—thecreativegeniusesbehindamerica'stestkitchenreleasedtheirsecondvegancookbook,thistimewith200+recipesforeverythingyoulovetoeat.plant-basedathlete($17)–itmightbeastretchtocallthisacookbook,butthenytimesbestseller,theplant-basedathlete,byourownmattfrazierisacompleteguidetoeatingapowerfulplant-baseddietandthrivingasanathlete,plusitincludes60uniquerecipes. yogaorfitnessclasses($50)doesyourlovedonehaveayogastudio,gym,orfitnessclasstheycan’tgetenoughof?supportthathabitbypurchasingagiftcertificateorclasspasstotheirfavoritespot. cookingclassescookingclassesarebothfunandinformative,andcanbeagreatwayforsomeonenewtoaplant-baseddiettogetinspired.mostcitieswillhaveplant-basedcookingclassesavailable,oryoucanfindonlinecourses,likerouxbe. onlinelearningcourses($15/m)fromlanguagelearningtohowtodoakickflip,wenowhavein-depth,expert-ledcoursesavailableonjustaboutanysubject.asubscriptiontoaservicelikemasterclassorduolingocanunlockendlesshoursoflearningandentertainmentforyourlovedone. eco-friendly,plant-based‘nicetohave’giftsmattandnatveganleatherbelt—forher($40)fashioncangetalittletrickyforpeoplewholiveaplant-basedforveganlifestyle,especiallywhenitcomestoshoes,wallets,orbelts.agiftofaveganleatherbeltcanbeusedforyearstocome. personalizedminiwallet($16)alongthesamelinesasbelts,manyplant-basedeatersarelookingforwalletsthatfittheirlifestyle.thesepersonalizableminiwalletsarefun,expressive,andstylish.tom’sslippers($60)it’sslipperseason,andicouldn’tbehappieraboutit.butfindingaqualityveganslipperisoddlydifficult,butthesetom’slolaslippersforwomenandezraslippersformenarebothcomfortableandfashionable.don’teatthehomiesshirts($40)lookingforagiftforsomeonewholikestooutwardlyexpresstheirdiet?looknofurtherthandon’teatthehomies,funshirtsandsweatsthatcaughttheeyeofconrad,oneofthenewestcomplementteammembers.complement’sinsulatedstainlesssteelshaker($30,plus20%off)leakyplasticshakersareathingofthepast.ourbrandnewdouble-wallvacuum-insulated,kitchen-gradestainlesssteel,leak-proofshakerisperfectforsmoothies,greenjuices,proteinmixes,andmore.whenisaythisthingisnicetohave,imeanit.ourteamcarriesthesearoundtothegym,inthecar,’stheperfectshakerbottleforanyoccasion.andrightnowyoucansave20%withcodeshaker20(autoappliedatcheckout).

Plant-Based Gift Guide: 18 Last-Minute Gifts Under $60

+Read article

Crunchy Green Beans Amandine Recipe
crunchygarlickygreenbeansamandineby:complementdon’tbedeceivedbytheshortlistofingredientsandthesimplisticcookingmethods–thisvegetablesidepacksaseriouspunch.slatheredingarlicandcoveredincrunchytoastedalmonds,thiswillbethatdishthatwillsurprisepeopleastheyrealizetheykeepreachingformore.ingredients: 2lbsgreenbeans,trimmed2tablespoonsoliveoil¼cupslivered,sliced,orchoppedrawalmonds5clovesgarlic,minced½teaspoonsalt½lemon directions heat1tablespoonoliveoilinapanovermediumheatandtossinthealmonds.stiruntilverylightlytoastedthenaddin⅓ofmincedgarlic.stiruntilgarlicissoftandfragrant,removefrompanandsetaside.add1tablespoonoliveoiltothepanandtossinthegreenbeans.sauteethegreenbeansuntilslightlytender(ormoredependingonhowsoftyou’dlikethem).addtheremaininggarlicandsautetogetheruntilthegarlicislightlybrowned.transferthebeanstoadishandsprinklethetoastedalmondsoverthetop.squeezelemonjuiceoverthetopandserve.recipeby:

Crunchy Green Beans Amandine Recipe

+Read article

Plant-Based Maple Pumpkin Pie Recipe
plant-basedalmondcrustmaplepumpkinpieby:complementpumpkinpie,themostquintessentiallythanksgivingdessert.wehavetakenthistraditionaltreatandturneditintoahealthyplant-basedversionthatisstillguaranteedtodelightallwhotasteit.finishyourfallfeastoffwiththisdeliciousdessertorevenhaveasliceinthemorningtogowithyourcupofcoffee!ingredients: forthecrust:1½cupsalmondflour¾cupwholewheatorgluten-freeflour(opt.replace¼cupwithcomplementunflavoredprotein)½teaspoonsalt7tablespoonswater1tablespoonmaplesyrup forthefilling:1½canspumpkinpuree(22½oz)⅓cupmaplesyrup½cuppitteddates½cupplantmilk¼cuparrowrootpowder1teaspoonvanillaextract2tablespoonspumpkinpiespice directions forthecrust:preheatovento350.addalldryingredientsintoabowlandstirtocombine.addthewaterandmaplesyrupandstiralltogetheruntilacohesivedoughforms.kneadabitwithyourhandstomakesureitstaystogetherandfromaball.placebetweentwopiecesofparchmentorplasticwrapandrolloutwitharollingpinuntilabout¼inthickanditextendsbeyondthecircumferenceofyourpiedish.transfertherolledoutdoughtoyourpiedishandpressinevenly.pokesomescatteredholesinthebottomofthecrustwithafork.bakefor20minutesoruntillightlygolden.removeandletcool. forthefilling:soakdatesinhotwaterfor20minutes,thendrain,squeezingallliquidout.addallofyourfillingingredients,includingdraineddates,intoyoublender.blenduntilcompletelysmooth.pourintopar-bakedandcooledcrust,andputitinyour350oven.bakefor40minutesuntilthetopissetandsmoothtothetouch.allowtocoolbeforetransferringtotherefrigeratorandchillingovernight.itmustbechilledallthewaythroughtocutproperly.enjoywithsomecoconutwhiporonitsown!recipeby:

Plant-Based Maple Pumpkin Pie Recipe

+Read article

Flexible 7-Day Plant-Based Meal Plan
7dayplant-basedmealplantojumpstartyournutritionby:complementsowe''reaskedtostayatworkabitlonger,yourkidsarechanting"pizza,pizza"fordinner,oryougethomeandrealizeyouwouldratherstarvethanstepfootintoyourkitchenthatnight.that'sjustlife–butunfortunately,mostmealplansdon'tseemtotakethatintoaccount.somanypeoplestartoffstrongwiththeirmealplans,justtoendupquitting,duetotherigorousandrigidrulesputinplace.wedon'twantthatforyou.wewantyoutosucceed,nomatterwhat.ifyouskipameal,aday,orevenafewdaysofyourmealplan,thatshouldn'tmeanyouhavetothrowinthetowelandforfeittherest.youshouldhavethefreedomtopickrightbackupwhenyouwant,andfinishonyourowntime.that'swhyweteamedupwithourin-houseregistereddietitiantocreatewhatmayjustbethemostflexiblemealplanyou'lleversee–atleastthat'swhatwewereaimingfor.therearesomanygreatbenefitsthatcomewiththeprocessofmealplanningandwewanteveryonetohaveachancetoencorporatethemintotheirlives. healthoneoftheobviousbenefitstofollowingahealthyandnutritionallybalancedmealplanarethemanywaysitcannourishandhealyourbody.whenyou'repreparingyourownfood,youcanmakesureonlywholesomeingredientsarebeingusedandactivelyavoidallthejunk–whichisn’talwaysguaranteedwheneatingout.followingahealthymealplancanalsoencourageyoutoformthehabitofcookingandchoosingfoodsthatarebetterforyouandanyoneelseyoucookforinthelong-run.varietymealplansnotonlyserveasapracticaloutlineforyoursuccess,butalsoasasourceofinspirationandmotivationtocontinuenourishingyourbodywithhealthfulplant-basedfoods.ratherthanorderingyourusualtake-outorthrowingtogetheryourstaplecasserole,youcantryoutanewvarietyofmeals,incorporatenewflavors,andreallyshakethingsupinthekitchen.conveniencenoguessingwhatyouwillbecookingthatnightorrummagingthroughtherefrigerator30minutesbeforedinnertime,whichisjustexponentiallyharderwhenyouhaveafamilytocookfortoo.whenyouhaveamealplan,youcanhaveeverythingboughtandpreppedaheadoftimeorevenfullymadeaheadoftime–especiallyusefulforthoseextrabusydaysinthemiddleoftheweek.accountabilitywhenyou’veproactivelysetyourselfupwithahealthyplanofactionforyourfoodintake,itleavesmuchlessroomforvariablessuchasrashdecisions,slipups,orhangrybingeeating.havinganactualchartthatyoucankeepwithyouandcontinuouslyreferencewillnaturallysetagoalforyoutoachieve.andit’snotsomekindofboringchoreeither,it’safunlittleadventurethatcanbenefityouandyourwholefamily’snutritionalhealth. whyourmealplanisdifferent nomatterwhatyourhouseholdsize,kitchen-skilllevel,andworkscheduleis,thisplant-basedmealplanwasbuiltwiththeflexibilitytoworkwithyou.userfriendlyrecipessomeofuswouldliketomakefunandhealthyfoodwithoutrequiringtherefinedskillsetofanironchef.whenwecreatedourmealplan,wekeptallofthesethingsinmind.wewantedtosharesomethingthatalllevelsofhomecookscouldappreciate–from,“i’mnotsurehowtoboilbeans”to“ibringmyownsetofkniveswhenitravel.”affordablemanyamealplanisguiltyofcallingforspecialtyingredientsthatmayactuallyendupcostingyoumorethanifyouweretojusteatout.wemadesuretouseingredientsthatyouarelikelytoalreadyhaveinyourpantry,andifnot,itwon'trequireavisittoapricyboutiquemarket.timesavingwhenyoudelegateyourtimewiselyandmealprepaheadoftime(especiallybeforetheworkweek),youcansaveyourselfalotoftroubleonbusydays.havebreakfastswaitingforyouwhenyouwakeupandlunchesallsettograbasyourunoutthedoor.adaptabletofityourneedsthesearerecipesthatcanbealtered,subbed,tripled,orevenalltogetherskipped,dependingonyouruniquecircumstancesandtastes.ifyouarefocusingonbuildingstrength,consideruppingtheproteinsourceineachmealoraddinganextrasourceofprotein,suchasproteinpowder.ifyouareavoidingoils,replaceanyofthecookingoilwithsomewaterinsteadandoptforcastironorceramicnon-stickpanstocookwith.ifyouarecookingforapartneroryourwholefamily,makesuretoscaleupyourportionsandrecipestoaccountforthis!theseareonlyafewexamples.justrememberyouhavethefreedomtobendthismealplantoyourwill.sowhetheryou’reaplant-basedveteran,anewbiesprout,orjusttestingthewaters,thismealplanisagreattooltousenomatterwhatstageofyourplant-basedjourneyyoufindyourselfin.theveryideaatthecoreofthismealplanisfreedom. mealplanwalkthrough(aka,howitworks) alllistedrecipeportionsareforsettogoforthesolomealplanner.ifyouaredoingthiswithapartnerorthewholefamily,makesureyourrecipesandportionsarebeingadjustedbeforeyoustart!day0:prepareyourtwobreakfastsworthofovernightoats,alongwithanyoftheotherfoodsforthenextfewdaysthatyoumaynotwanttopreparetheday-of(especiallyifyouarestartingonamonday).ifyouaretakinglunchwithyou,it’suptoyouwhetheryouwanttopackitupthedaybeforeormorning-of,beforeheadingout.day1:hopefullyyoudidn’tforgettoprepyourovernightoatsforyourfirstmealoftheplan!ifyoualreadypreparedyourfalafelmashandrefriedblackbeansaheadoftime,lunchanddinnerwillbeabreeze.makesureyouareputtingasideaportionofrefriedblackbeansforyourlunchonday2.day2:greatbreadchoicestohavewithyouravocadotoastaresproutedwheatororganicsourdoug.lunchisleftoverquesadillasfromthenightbefore,anddinnerisalovelysheetpanmedleyoverquinoa.remembertomakelotsandsetagoodamountaside–especiallythequinoabecaueitwillbeusedforday3and4.day3:yourovernightoatsshouldbereadytoreceivewhateverfruittoppingyou’reinthemoodfor.forlunchyouarecreatingatofunoodlebowlusingleftoversfromthenightbefore.dinnerisahardygrainsaladalsomakinguseoftheleftoversfromlastnight!wastenot,wantnot. day4:avocadotoasttostartyourday,maybewithsomenewtoppingsforvariety?forlunch,themediterraneanbowluseswhateverquinoaleftfromthepreviousnight.andfordinner,adelicioustofucurrywillgogreatwithsomebrownrice(savesomeforlunchtomorrow)!tonightyou’llalsowanttogoaheadandpreparetwodaysworthofchiapuddingforbreakfast.day5:yourchiapuddingshouldbecreamy,plump,,asimpleleftovermealoftofucurryandbrownriceforlunchandanamazingbeanburgerfordinner.don’tforgettosaveaburgerpattyforyourlunchtomorrow.day6:theseapplepecanproteinpancakesaremadeinonesheetpanintheoventokeepthingssupereasy.lunchwillbeaburgersaladusingapattyfromthenightbeforewithwhateverburgertoppingsanddressingyou'dlike.fordinner,enjoysomedeliciouslyfuntofutacos–andremembertokeepsometofuforyourlunchtomorrow!day7:enjoyyourpre-madechiapuddingforbreakfastwithsomevariedtoppingstokeepthingsinteresting.forlunch,useyourtofuleftoverstomakeahealthytacosalad.andforyourfinalmealoftheplan,abeautifullysimplecreamytomatorotini. thesearen'trules,they'’simportanttoknowthatthereisfreedomtochangewithintheplan.evenifyousubouthalfofyourmealsoringredientsorturnitintoa14-daymealplan,youcanstillmakeityourownsuccess.wedidn'tincludetreatsandsnacksbecausewewantyoutobeabletosnackonwhateverisconvenientandtastysoundingtoyouinthatmoment.wedosuggeststockinguponhealthysnackslikefreshfruitsandveggies,hummus,simplepopcorn,nuts,vegandarkchocolate,healthyplant-basedbarsandbites,smoothies,orproteinshakes.onceyoucompletethissimpleanddeliciousmealplan,you’llhavetheexperienceandconfidencetoformyourveryown.youcanfollowthesameguidelinesweusedtocreateours(fromouramazingregistereddietitian,amandawagner)andhangontoallofthehealthyandconvenientbenefits!  mealplanshoppinglistdon'tbedauntedbythelengthofthislist!chancesare,you'vealreadygotover50%oftheingredients,asmostofthesearepantrystaples.dependingonhowmanypeopleyouarecookingfor,theamountofeachingredientwillvary.thesemeasurementsarehowmuchyou'llneedforonepersonforthewholeplan.makesuretoadjustifyouareincludingforyourpartnerorfamily! rolledoats(1c)plantmylk(1carton)maplesyrup(1/2c)chiaseeds(1c)peanutbutter(1c)cannedchickpeas(2)veganyogurt(2c)curlyparsley(1bunch)garlic(1head)cuminpowderchilipowdergarammasalacayennepeppercurrypowdersmokedpaprikaonionpowdergarlicpowdercinnamonnutritionalyeastjalapenos(1freshor1smallcan,optional)lemons(3)greensofchoice(1lb.)tomatoes(3)tortillas(1pack)blackbeans(2-15oz.cans)onion(1)cilantro(1bunch)loafofyourfavoritebreadtoastedsesameseeds(1t–anoptionalgarnish)tahini(1c)firmtofu(3blocks)bellpepper(3)sweetpotatoes(4)broccoli(2crowns)oliveoil(1-2c)soysauce(1c–canusetamariorcoconutaminos)balsamicvinegar(1/2c)quinoa(3cdry)ricenoodles(1package)cucumber(2)sesameoil(1smallbottle)limes(2)peanuts(1c–oranothernutofchoice)pecans(1/2c–oranothernutofchoice)apple(2)applecidervinegar(¼c)dijonmustard(2t)tomatosauce(3-8oz.cans,plain)coconutmilk(1can)brownrice(1cdry)raspberries(oranyotherberryofchoice)proteinpowder(2c–trycomplementprotein)groundflaxseed(1t–canalsousegroundchia)breadcrumbs(½c)sriracha(oranyotherhotsauceofchoice)veganmayo(1t)oatflour(2c)bakingpowder(2½tsp)beanflourrotinipasta(oranyotherpastashapeofchoice)tomatopaste(1smallcan)cornstarch(1t)freshbasil(1smallbunch) mealplanrecipes ingredients: 1/2crolledoats1tchiaseeds1tpeanutbutter(oranyothernutbutterofchoice)1-2tmaplesyruppinchsalt1/2cplantmylk directions addallingredientstoabowl,container,orjar.stirorshakeitup,leavetothickenovernight.topwithfruitsofchoice,somegranola,orchoppednutsandenjoy!thisisasingleserving.doubleortrippletoyourneeds.overnightoatsisalsoagreatplacetoaddinsomeproteinpowder!makes1serving.ingredients: 1-15oz.canofchickpeas2tplant-basedyogurt1croughlychooppedparsley1clovegarlic,chopped1/2tspsalt1tspcuminpowder1tlemonjuice(about1/2alemon)handfullofgreensofchoice1/2smalltomato,sliced1tortillaorwrap(preferablywholewheat) directions addallingredientsintoaprocessor.pulseuntilcohesivebutstillchunky(ormashitallwithafork).addsomelettuceandtomatotothewrap,thenaddsomeofthechickpeamash,wrapitallup,anddevour.makes2servings.ingredients: 1-15oz.canofblackbeans2toliveoil2clovegarlic,chopped1/2smallonion,chopped1tlemonjuice(about1/2alemon)1/3cchoppedcilantro1tspcuminpowder1tspchilipowder1/4cupjalapeños,sliced(canusedcannedorfresh)tortillasveganyogurttodip directions heatupapanovermediumheatwiththe1toliveoilandaddthechoppedonions,cuminpowder,andchilipowder.cooktilonionsaretender.addinchoppedgarlic,stirfor1minute.addtheblackbeans,cooktilhot,andputitinabowl.addthecilantroandlemonjuice,andmashituproughly.wrinseyourpanout,dryit,andputitbackovermediumheatwith1toliveoil.addyourtortillatothehotpan,spreadsomeblackbeanmixontop,afewjalapeñoslices,andnutritionalyeast.closeitupwithanothertortilla.panfryonbothsidestilbrowned.enjoywithyourfavoritehotsauceandsomeveganyogurt!shouldmaketwolargequesadillas.ingredients: 1avocado2slicesofyourfavoirtebreadslicedtomatoes1tsptoastedsesameseeds1ttahinisaltandpeppertotaste directions halfyouravocado,takeoutthepit,spoonoutthegoodstuff,andmashitontoyourbreadslices.takeyourtomatoslicesandlaythemontop,thensprinklewithtoastedsesameseeds,salt,pepper,,thisisaverybasicrecipethatyoucanhavefunwithandplaywiththetoppingsasmuchoraslittleasyou'dlike.hereareafewtoppingsuggestionstojazzupyouravocadotoast:hempseedschoppednutsbalsamicdrizzlesirachanutritionalyeast(thehandy-dandynooch)salsatempeh(forsomeextraprotein)cookedbeans(alsogreatforprotein)makes1serving.ingredients: forthesheetpanmedley:1blockfirmtofu2bellpeppers2sweetpotatoes2crownsbroccoli3toliveoil1tsoysauce(tamari/coconutaminos)1tbalsamicvinegarsaltandpeppertotaste1/2avocado,cubed1handfullgreensofchoiceforthequinoa:2cquinoa21/2cwaterdirections forthesheetpanmedley:setoventoroastat400°f.gentleypresstheliquidoutofthetofuwithakitchentowelorpapertowels,thencutintobitesizecubes.putthecubesinabowlandaddinthesoysauceand1toliveoil.tossaroundgentlyuntilalltofuiscoated,thenaddtosheetpan.cutthebellpeppers,sweetpotatoes,andbroccoliintobitesizepieces,addthemintothebowlyouusedtoseasonthetofu.addoliveoilandacouplesmallpinchesofsaltandpepper,tosstocoat.addveggiestosheetpanandmakesureeverythingisspreadout,thenaddtoovenfor15min.turnyourpanat15minandroastforanother10min,thenremoveit.forthequinoa:combinethequinoaandwaterinamediumpot.bringtoaboil,cover,reducetheheat,andsimmerfor15minutes.removefromtheheatandletitsit,coveredfor10moreminutes.fluffwithafork.assemble:putsomequinoainyourdinnerbowl,addthehandfullofgreens,theavocado,andsomeoftheroastedmedley.drizzlewitholiveoilandbalsamicvinegar,andit'sreadytogo.makes3servings.ingredients: 1/2packagericenoodles1portionofyoursheetpanmedleyleftovers1/3cucumber,sliced1tspsesameoil1tspsoysauce(tamari/coconutaminos)1tpeanutbutter(oranyothernutbutter)2twater1/2lime1/2smallbunchofcilantro2tchoppedpeanuts(oranyothernut) directions bringasmallpotofwatertoaboil,addyourricenoodles,cookaccordingtopackage.drainyournoodlesintoacolander,runundercoldwater,anddrain.onceallwaterhasbeendrained,addthenoodlestoyourbowl,addthesheetpanmedleyleftoversandslicedcucumbersontop.combinethesesameoil,soysauce,peanutbutter,juicefrom1/2lime,andwaterinasmallcontainer,andstirtomakeasauce.pourthesauceoveryourbowl,andgarnishwithchoppedcilantroandpeanuts.mixalltogetherandenjoy!makes1serving.  ingredients: 4-5cupsofyourfavoritegreens1portionofyoursheetpanmedleyleftovers1/3cquinoa1/4apple,sliced1/4ctoastedpecans2tapplecidervinegar2toliveoil1tdijonmustard2tspmaplesyrupcouplepinchesofsaltpinchofpepper directions addyourfavoritegreenstoyourdinnerbowl(makesuretheyhavebeenproperlywashed).addwhat'sleftofyoursheetpanmedleyleftotvers,1/3cofleftoverquinoa,toastedwalnuts,andappleslices.inasmallbowl,mixtheoliveoil,applecidervinegar,dijonmustard,maplesyrup,salt,andpeppertomakeyourdressing.pouroveryourbowl,tosseverythingtocombine,andmaybeenjoywithasliceofyourfavoritebread.makes1serving.ingredients: 1cquinoa1-2cofyourfavoritegreens1/215oz.canofchickpeas(about1/2c)1/3cchoppedtomatoes1/3cchoppedcucumber1/3cchoppedcurlyparsley1/3cveganyogurt1smallclovegarlic,grated1lemon,juiced1/4ctahini1-2tcoldwaterpinchesofsaltpinchofpepper directions addthequinoaandyourfavoritegreenstoyourbowl(makesurethegreenshavebeenproperlywashed).drainthecannedchickpeas,wrinse,andaddhalfofthecantoabowl.addapinchofsalt,thecumin,andtosstocoat.addthisoveryourquinoaandgreens.addthechoppedparsley,tomatoes,andcucumbertothebowl.inasmallseparatecontainer,mixthe1/3cofveganyogurtwiththegratedgarlicandasalttotaste.addthisontopofyourbowl.inasmallbowlcombinethelemonjuice,andtahini,andstirtogether(itwillgetthick).slowlyaddthewaterasyoustir,untilyougettopouringconsistency.thenaddyoursaltandpeppertotaste.finally,drizzleyourtahinisauceoveryourbowlandit'sdone!makes1serving.ingredients: 1packagefirmtofu2toliveoil1/3cchoppedcilantro3ctomatosauce(plaincanned,notseasonedwithherbs)11/2tspgarammasala(orcurrypowder)1/2tspcayennepepper1/3cfullfatcoconutmilk1tmaplesyrup1largeclovegarlic,grated1/4-1/2tspsalt1cbrownriceoranyotherwholegrainofchoice directions setoventoroastat400°f.cookyourpreferredgrain(stovetop,ricecooker,pressurecooker,orevenpre-cooked/microwavable)drainandpressthetofu,gettingoutasmuchmoistureaspossible,thencutintobite-sizecubes.inabowl,tossthetofucubeswith1toliveoilandapinchofsalt,spreadonapanandroastinovenfor15min.whilethat'sroasting,takeapanandputitovermediumheat.addin1toliveoilandthegarammasala,stirtogetheruntilfragrant(about1minute).addtomatosauce,gratedgarlic,maplesyrup,cayenne,andstirfrequentlywhilesimmeringforafewminutes.addthecoconutmilkandstiroverheatforacouplemoreminutes.removefromheatandaddsalttotaste.serveoveryourcookedgrainofchoice,garnishedwithchoppedcilantro.makes2servings.ingredients: 1/4cchiaseeds1/4craspberries1tmaplesyrup1/2cplantmylkpinchofsalt1servingproteinpowder(optional) directions combineallingredientsinajarorbowlandmixorshaketocombine.letitworkit'smagicovernight,andtopwithmorefreshraspberriesandsomegranolatoserve.dependingonwhetherornotyouaddproteinpowderandwhetherthatproteinpowderissweetenedornot,youcanleaveoutthemaplesyrup.addingprotienpowderisagreatwaytomakethisbreakfastmoresatiatingandcomplete.thisisjustabaserecipethatyoucanplaywithandaddwhateverfruit,seasonings,ortoppingsyoufeellike.makes1serving.ingredients: forthebakedsweetpotatofries:2mediumsweetpotatoes1toliveoilgenerouspinchofsaltandpepper1tspsmokedpaprika fortheburgers:1tbspgroundflaxseed+3tbspwater(canusegroundchiaseed)1-14.5ozcansblackbeans,drainedandrinsed1/2cupbreadcrumbs1tsponionpowder1tspgarlicpowder1tspcumin1tspchilipowder1tspsmokedpaprikagenerouspinchofsaltpinchofblackpepper1tbspsriracha(orhotsauceofchoice)1toliveoilbunburgerfixings(whateveryoulike–veganmayo,tomato,lettuce,onion,mustard,etc.) directions forthebakedsweetpotatofries:preheatovento425°f.cutthesweetpotatoesintolongstrips,tosstheminabowlwith1toliveoil,agenerouspinchofsaltandpepper,andsmokedpaprika.bakeonagreasedpanfor15min,carefullyremovethepanandtossthemaround.returntoovenforanother10minutes.fortheburgers:placeflaxandwaterinasmallbowl.setasidetothicken.placebeansinalargebowl.mashwithapotatomasherorforkuntilmostbeansarebrokenup,leavingsomewhole.addbreadcrumbs,onionpowder,garlicpowder,cumin,chilipowder,smokedpaprika,salt,pepper,sriracha,andflaxmixture.stiruntilwellcombined.forminto2-3tightlypackedpatties.youcanrefrigeratethemuntilyouarereadytocookorcookthemrightaway.warmaskilletovermediumheatwitholiveoil.cookburgersforabout6minutesperside,oruntilgoldenbrown.buildyourburgerandenjoywithasideofsweetpotatofries.makes2largeburgers,or3mediumburgers.ingredients: 1coatflour(youcanmakeyourownbyblendingrolledoatsuntilfine)2tproteinpowder1/4teaspoonsalt1½teaspoonsbakingpowder3/4cupplantmylk2tmaplesyrup(plusmoreforserving)1/2tspcinnamon1/2apple,sliced2tchopopedpecans directions setovento420°f.inabowl,combinetheplantmylk,maplesyrup,andcinnamon.addtheoatflour,proteinpowder,salt,andbakingpowder.mixuntilfullyincorporated.stirinappleslicesandchoppedpecans(savesomeappleslicesandpecanstoplaceontopforapicture-worthyfinish).letsitforabout15minutestohydratetheoatflour.pouroutontoa13”x9”sheetpan.decoratewithsavedappleslicesandchoppedpecans(ifyoukeptsome).bakeforabout12-15minutes,untilatoothpickcomesoutclean.letcoolslightly,thencuttoserve.enjoywithsomemorefruitontop,adollopofveganyogurt,andadrizzleofmaplesyrup.makesabout2servings.ingredients: 1blockfirmtofu2tablespoonssoysauce1tablespoonapplecidervinegar¼teaspoonkoshersalt1teaspoongarlicpowder1teaspoonchilipowder1teaspooncumin2teaspoonssmokedpaprika3tablespoonsoliveoil,divided fortacotoppings:tortillas1cgreensofchoice1lime,cutintowedges1/3cfreshcilantro,choppedveganyogurthotsauceortacosauceofchoice directions drainthetofu,thenpatthetofudrywithatowel.placethetofuinalargebowlanduseyourfingerstobreakthetofuintoroughlybite-sizedcrumbles.stirinthesoysauce,vinegar,salt,garlicpowder,chilipowder,cumin,smokedpaprika,and2tablespoonsoftheoliveoil.heattheremaining1tablespoonoliveoilinpan.addthetofuandcookonmediumhighfor8to10minutes,breakinguplargepiecesintobitesizedchunksandstirringoccasionally,untilbrownedandlightlycrispyandtheliquidevaporates.spritzgreenswiththejuiceof2limewedgesandaddafewpincheskoshersalt.mixtheveganyogurtwithhotsaucetotaste,andaddafewpinchesofsalt.placethetofucrumblesinthetortillas,thentopwithtoppingsandenjoy.makes2-3servings.ingredients: 1/2box(8oz.)ofdryrotinibeanpasta(pastamadefrombeanflour)1toliveoil2clovesgarlicminced2ttomatopaste1cplantmylk2tnutritionalyeast1tcornstarchdilutedin2troomtemp.water1/2tspsaltpinchofpepper1/3cfreshtomatoes,choppedhandfullofgreensfreshbasilforgarnish directions boilbeanpastaaccordingtopackage,drain,andsetaside.heat1tofoliveoilinasaucepanovermediumheatandaddinthemincedgarlic.oncethegarlicisfragrant,addinthetomatopasteandstirforafewminutes.addintheplantmylkandnutritionalyeast,thenbringtoasimmer.stirtogetherthecornstarchandwater,makingsurenoneisstuckatthebottom.addtothepotandstirvigorouslyuntilthickened.addsaltandpepper,taste,addmoreifneeded.addinthepasta,thespinach,andthechoppedtomatoes,mixitup,andservewithbasilgarnish.topwithsomemorenutritionalyeast.usingbeanflourpastaforthisdishaddsaheftyamountofproteintomakethisacompleteandbalancedmeal.anddon'tworry,itdoesn'ttastelikebeans.makes2servingsasamaindish.recipesby: soyoufinishedthemealplan,nowwhat?firstoff,congratulationsareinorder! withthisexperienceunderyour(veganleather)belt,youcannowconfidentlymoveintocreatingyourveryownmealplan.feelfreetoreallymakeityourown,eitherbuildingsomethingveryconcretelikewhatwehave,orsimplyalooseoutlinetoguideyouthroughtheweek.goingthroughtthemotionswiththeprocesswillleadtoadoptingthesehealthyhabitsintoyourlifeforthelong-run.youcanfollowtheexacttipsweusedtodesignourplant-basedmealplan. registereddietitian,amandawagner’samazingmealplanningtips: planoutwhatyouwanttoeatfortheweek.doyouliketohavecertainmealseveryweek?i.e.tacotuesdayorpizzafridays?startthere!checkcookbooksyoualreadyown&socialmedia(i.e.instagramandpinterest)forinspiration.ourwebsiteisalsofullofsimpleandnourishingrecipesthatyoucanuse.thiswouldalsobeagoodtimetodecideonhowyouwantyourmealplanningtolook.doyouprefertocookfromscratcheachdayorwouldyouprefertopreparewhatyouneedbeforetheweekstarts?2.balanceyourmeals.makingyourmealsasnutritionallybalancedaspossiblewillhelpyoustayfull,worktowardyourhealthgoals,andfeelenergized.makesureallofyourmealshaveaproteinsource,veggies,ahealthyfatsource,andwholesomecarbohydratesource.agoodgoaltoaimforpermealisaround500calories(activepeoplemayhavehigherneeds),around20gramsofprotein,lessthan3gramsofsaturatedfat,around15gramsofhealthyfats,80gramsofcarbohydrates(activepeoplemayhavehigherneeds),andatleast5gramsoffiber.also,ifyousaltyourfood,ideallyuseiodizedsalt,sinceiodineisanutrientmanyplant-basedpeoplefallshorton. 3.usewhatyou'vegot.checkyourpantry,refrigerator,andfreezertoseewhatingredientsyoualreadyhavewhenplanningyourmeals,’seasiertosticktoabudgetandaplanifyouwriteoutyourshoppinglistaheadoftime.ipersonallyusethenotesapponmyiphone,butanoldfashionedpenandpaperlistworksgreattoo.6.don’tforgettobringyourlisttothegrocerystore!focusonwhat’sgoingtobeconvenientandbestforyourlifestyle.frozenfruitsandvegetablesarefrozenatthepeakoffreshnessandcanbejustasnutritiousastheirfreshcounterpartsandeasieronyourbudget!don’tbeafraidtohaveafewquickoptionsforthose“ineedhealthyfood,butcannotfathomcookingrightnow”daysornights.ifbuyingapre-madeorfrozenplant-basedmeal,makesureyoucheckthenutritionfacts.aimforamealthathaslessthan500mgofsodium,lessthan5gofsaturatedfat(thelowerthebetter),notrans-fat,andideallyincludessomefiber.youcanalwaysaddasaladorsautesomeveggiestomakeyourfrozenmealmorecolorfulandwell-rounded.7.getprepping. assembleanyingredientsyoucanaheadoftimeifyouarecookingdaily.thisincludessnacks.ifyouarebatchcooking,irecommendfreezingyourportionsbeyonddays3or4forfoodsafetyandfreshness.evenifyouaren’tsuperexcitedaboutbatchcooking,youcouldatleastconsidersingleitemstomakeaheadoftimelikecookedgrainstostoreinthefreezer,breakfasts,orsnacks.

Flexible 7-Day Plant-Based Meal Plan

+Read article

Hearty Autumn Vegetable Ratatouille Recipe
heartyautumnvegetableratatouilleby:complementthisisn’tlikethefancythinlyslicedandlayeredversionofthedishpopularizedbytheanimatedfrenchratchef.thissimpleversionisstyledmorecloselytotheoriginalcountrystewcommonlypreparedandeatenintheprovençalregionoffrance.ifyoudon’thavefreshherbstouseforthisrecipe,adried“herbsdeprovence”mixturewoulddojustfine!ingredients: 1largebutternutsquash,seededandcutinto3/4-inchpieces1lbbrusselsprouts,trimmedandhalved3largecarrots,cutinto3/4-inchpieces1largegreenapple,cubed1tablespoonsoliveoilkoshersaltandfreshlygroundblackpepper1smallonion,chopped2garliccloves,finelychopped3sprigsthyme3sprigsrosemaryone15-ouncecandicedtomatoes¼cupcomplementunflavoredprotein directions tieyoursprigsofthymeandrosemarytogetherwithcookingtwine.heatthetablespoonofoliveoilinamediumpotovermedium-lowheat.addthechoppedonionandthetiedsprigsandcook,stirring,untiltheonionissoftened.addthegarlicandcookuntilfragrant.addthetomatoes,cutvegetables,andappleandturnyourheatuptomedium.turnyourstovetomedium-lowheatandbringtoasimmer,stirringoccasionallyuntilallvegetablesaresoftenedandjuicesareverythick,about30minutes.stirincomplementunflavoredproteinseasonwithsaltandpeppertotaste.servewarmwithsomebread,pasta,orsimplyonitsown!recipeby:

Hearty Autumn Vegetable Ratatouille Recipe

+Read article

Savory Mushroom Sourdough Stuffing Recipe
savorymushroomsourdoughstuffingby:complementthisbelovedthanksgivingsidedishisgettingaplant-basedmakeoverandnotgoinganywherenearaturkey.thesourdoughbreadgivesalittleextraedgetoanalreadydeeplysavoryandsatisfyingflavorprofile.addthisessentialdeliciousdishtoyourplant-basedthanksgivingspreadtocompleteyourfestivemenu.ingredients: ½boulesourdoughbreadcutintocubes1tablespoonoliveoil1yellowonionhalvedandsliced2cupsslicedcreminimushrooms(oranymushroomofyourchoice)3stalkscelerywashedandchopped1tspsalt3clovesfreshgarlicminced1tbspfreshsageminced1tbspfreshrosemaryminced2cupsvegetablebroth¼cupunflavoredcomplementunflavoredproteinfreshpeppertotaste directions preparethebreadbycuttingitintolargebite-sizedcubes.thisrecipeworksbestifthecubesaredry.todrythemout,leavethemoutonacountertopovernightortoasttheminalow-tempoven.preheatyourovento350º.addoliveoiltoapanwithhighsidesovermedium-lowheat.addtheonionsandstiruntilcaramelized(10-15minutes).addtheceleryandcookuntiltranslucent.addthemushroomsandcookuntiltenderandbrownedandallliquidhasevaporated.addthegarlic,sageandrosemaryandcookfor2-3minutesmore.addthevegetablebrothandstirincomplementunflavoredprotein,increasetheheatandbringtoalowsimmer.lightlygreaseacasseroledishwithasmallamountofextravirginoliveoil(oranotherplant-basedoil).fillthecasseroledishwiththebreadcubes.pourthebrothandveggiesoverthebreadcubesandgentlytosstocoatthebreadcubes.bakeat350ºfor45-50minutesonthemiddlerackuntilthestuffingisgoldenbrown.serveimmediately!recipeby:

Savory Mushroom Sourdough Stuffing Recipe

+Read article

Gingerbread Protein Smoothie Bowl Recipe
gingerbreadproteinsmoothiebowlby:complementthisgingerbreadproteinsmoothiebowlisthick,sweet,andwarmlyspiced,justlikegingerbreadcookiedough!you’lllovethatit’ssimpletomakeandkeepsyoufeelingfullforhours.bestofallit’shealthy,plant-based,andjustsohappenstobegluten-freetoo!ingredients: 2ripebananas1can(15oz/425g)ofwhitebeans,drainedandrinsed2/3cup(62g)ofrolledoats¼cup(60ml)ofplant-basedmilk2tablespoonsofcomplementunflavoredorganicproteinpowder2tablespoonsofblackstrapmolasses2tablespoonsofnutbutter4medjooldates,pitted1teaspoonofcinnamon½teaspoonofginger¼teaspoonofnutmeg⅛teaspoonofsalt directions addallyouringredientstoablender.blendatmediumspeed,workingyourwayuptohighspeed,untilsmoothandcreamy.stopandscrapethesidesofthecontainerifneeded.scoopintotwobowlsandtopwithadollopofnon-dairywhipcream!notes:recipecaneasilybecutinhalfforasingleserving.foragingerbreadproteinsmoothie,makeasingleservingandaddanadditional½cupofplant-basedmilk.

Gingerbread Protein Smoothie Bowl Recipe

+Read article

The Lowdown On Omega-3s — How Important Are They For Plant-Based Eaters?
thelowdownonomega-3s—howimportantaretheyforplant-basedeaters?thelowdownonomega-3s—howimportantaretheyforplant-basedeaters?by:complementwe’veallseenthegiantjugsofomega-3supplementsatcostcoorheardof(forsome,maybeevenexperienced)theaquaticaftertasteandthe24hoursworthofbrinyburpsthataccompanythem.butasdrovesofpeoplearepayingtoputthemselvesthroughthesenot-so-pleasantsymptoms,onemustwonder,areomega3sreallysoimportant?andifso,arethereanyreliable,non-fishysourcesthatmeettheneedsofplant-basedfolks?theshortanswersareyesandyes,andwe’lladdressbothinabit.butfirst,let’sgetintothenittygrittyscienceofomega3s. whatareomega-3fattyacids? omega-3fattyacidsareessentialfatsthatourbodiesneedtofunction.mostoftheotherfatsourbodiesrequirecanbeproducedinternallyinsufficientquantities,butomega-3smustbeobtainedthroughdiet,supplementation,oracombinationofboth.thereare3maintypesofomega-3fattyacids:ala(alpha-linolenicacid)isthemostcommonofomega-3sfoundinourtypicallyrichandfatty,westerndiet.itiscrucialinhelpingourbodiesdigest,absorbnutrients,andcreateenergy.thetwoothermainomega-3s,epaanddha,canbesynthesizedbyala,butonlyinverysmallquantities.ithasbeenshownthatonly0.5%-10%ofalaisconvertedinto“physiologicallyeffectivelevels”ofdhaandepa.epa(eicosapentaenoicacid)preventsthebloodinourbodiesfromclottingeasily,reducestriglyceridelevelsintheblood,andhasbeenshowntohelpreducepainandswelling.*dha(docosahexaenoicacid)playsasignificantroleinbrainandeyedevelopment.ithelpssupportmentalhealththroughoutearlychildhoodandevenintoadulthood.* don’tconfuseyour3sand6s.,seeds,andvegetableoils—oftenconsumedintheformofprocessedandfriedfoods.despitesomeofitsmorequestionableandlessthanhealthysources,omega-6fatsstillplayavitalroleinmakingsureyourbodyisoperatingproperlyonadailybasis.similarlytoomega-3s,theyhelpregulategrowth,development,andenergyconversion.mostamericansalreadytakeinfarmoreomega-6fatsthantheydoomega-3(someresearchpointstoasmuchas14to25timesmore),makingitmuchlesssoughtafterasasupplement. whatarethebenefitsofomega-3fattyacids? omega-3sareindeedcrucialtoyouroverallhealthandwellbeing,tirelesslyworkingtoassisteverycellinyourbody.regularintakeoftheseessentialfattyacidsiscriticalforoptimalfunctioning—fromregulatingourcholesterollevelstopoweringournervoussystems.*thousandsofstudieshavebeenconductedonthevariouseffectsandbenefitsofomega-3s,andwearestillcontinuingtodiscoverevenmoretothisday. herearesomeofthemajorbenefitsofomega-3fattyacids,asoutlinedthroughthelatestresearch: supportsmetabolicfunction  consumingtoofewomega-3scanleaveusfeelingphysicallyandmentallysluggish.nowthisdoesn’tnecessarilymeanthattakingextraamountsofomega-3swillprovidesomekindofespresso-likeboost,butgettinganadequateamountisabsolutelyessentialinkeepingenergyproductionsteadyandmetabolichealthfunctioningatahighlevel.*ina2013study,omega-3sweregiventoagroupof24womenbetweentheagesof60-76,whowereexperiencingadeclineintheirmetabolicefficiency,withanincreaseinfatmassanddecreaseinmusclemass(anaturalprocessthat,unfortunatelyforallofus,occurswithaging).overaperiodof12weeks,theyweregiven3gramsofomega-3supplementperday.variousphysicalandmetabolicmeasurementsweretakenatthebeginningandtheendofthetrialforafinalcomparison.theresultswereextremelypromising,withthefollowingmeasurementsrecorded:restingmetabolicrateincreasedby14%energyduringexerciseincreasedby10%fatoxidationincreasedduringrestby19%fatoxidationincreasedwhileactiveby27%leanbodymassincreaseby4% whilethisstudywasconductedonasmallsamplesize,theresearchersconcludedthatuppingyourintakeofomega-3scouldpotentially(andsignificantly)improveage-relatedmetabolicchanges. supportshearthealth thismaybethemostwidelysharedandresearchedbenefitthatomega-3fattyacids(specificallyepaanddha)bringtothehealthtable.increasedintakehasbeenrecommendedbytheamericanheartassociationforthepast20yearstohelpreducecardiovascularevents,likeheartattacksorstrokes,anddoctorsandscientistshavebeenresearchingtheshortandlong-termeffectsthattheseessentialfatshaveonourbodies.sowhatexactlymakesthem“hearthealthy”?severalstudieshaveshownthatindividualswhoconsumedsomeformofomega-3afewtimesperweekhadalmostone-halftheriskofdeathfromcoronaryheartdiseaseandalmostone-thirdtheriskofdeathfromaheartattack,incomparisonwiththosewhoconsumedanegligibleamount.inonlya12weekperiod,increasedomega-3levelshavebeenshowntoreducetheamountoftriglyceridesinthebloodstreambyastaggering27%.*hightriglyceridelevelscontributetohardeningofthearteriesorthickeningofthearterywallsandareassociatedwithobesityandanincreasedriskofstroke,heartattackandheartdisease.* maysupportinflammationreduction whenyouthinkofinflammation,youmightimmediatelythinkofaswollenjointoranangrylookingcut.butinflammationcanalsobeamajorcontributortomultiplediseasesandlife-alteringconditions.inflammation,onabasiclevel,issimplythebody’snaturaldefensemechanismtohelppreventtissuedamageandinfectionfromvirusesandbacteria.butsometimestheinflammationdoesn’tgoaway,andthisiswhenitcanbecomedangerous,damaginghealthycellsandtissues.thereisalonglaundrylistofconditionsthatareassociatedwithchronicinflammation:atherosclerosisheartdiseasearthritisallergiesobesityhypertensiontype2diabeteschronickidneydiseasecancerandthat'sjustahandful.higherintakeofbothepaanddhahasbeenlinkedtoreducedinflammation(includingthechronic-kind),bydirectlyaffectingthefunctionofcellsandactivelydecreasingtheproductionofmoleculesandsubstancesthatcauseinflammation.* supportsfetal&infantdevelopment forpregnantwomen,omega-3fattyacidsplayamajorroleinchildhooddevelopment,specificallythefetalbrainandretina.*however,recentsurveysindicatethatpregnantwomen,bothintheunitedstatesandinothercountries,aren’tgettingenoughomega-3sintheirdiet.thiscomesasnosurprise,withfishbeingthemostcommonlyrecommendedsource,andmanypregnantwomenavoidingthisduetoconcernoverthemercuryandothercontaminantspresentinfish.variousanimalstudieshavedemonstratedthatnotgettingenoughomega-3fattyacidsduringpregnancycancauseirreversiblevisualandbehavioraleffects.guidelineshaverecommendedthatwomenconsumeatleast200mgofdhaperdaywhenpregnant.* whataboutkids?  manyparentsareunsureoftheroleomega-3splayinthelivesoftheirchildrenandifsupplementationisasafeoptionforthem.justlikewiththefetusinthewomb,omega-3splayanimportantroleinmaintainingachild'soverallbrainhealthandmayalsoaidsleepquality.providingplentyofsources,beitfoodoranappropriatesupplement,ofomega-3scanhelpensurethatchildrenaremeetingtheirdailyneedsandthriving. supportsbrainhealth wealreadyknowthatomega-3sareimportantforthedevelopmentofyoungbrains,butwhataboutourolderandslightlymoreweatheredadultbrains?omega-3sarealsoimportanttoadultbrainhealth.asweage,ourbrainsgothroughmanyphysicalandbiologicalchangesthatincludeshrinking(that’sright!)andadecreaseinomega-3levels.thiscanvaryfrompersontoperson,,whilesimultaneouslyimprovingproperbloodflowtothebrain.*theseallmaycontributetoslowingtheeffectsofage-relatedmemorydeclineandloweringrisksinboththedevelopmentandprogressionofdementiaandalzheimer’sdisease.*recently,there’salsobeenalotofinsightinregardstotheeffectsthatomega-3shavewithconditionssuchasdepression,anxiety,andpost-traumaticstressdisorder.whiletherearelotsofvariousfactorsthatcouldbecontributingtothesituation,animbalanceinserotoninanddopaminearelinkedtothesedisorders.increasingomega-3intakecouldbebeneficialinthetreatmentofdepressionandanxiety,duetoitspotentialinimprovingthetransmissionofserotoninanddopamine.* maysupportbonehealth  it’snotawidelyknownfactthatomega-3salsoplayapartinbonehealth.oneofthebiggestexacerbatorsofbonedeteriorationischronicinflammation.itcancauseourbodiestosendsignalstobone-removingcellscalledosteoclasts.theyareonlysupposedtoremoveoldandbrittleordamagedbone,butwithchronicinflammationinthemix,thesecellsgointooverdrive.sincebuildingnewbonetakesmuchlongerthanbreakingdownoldbone,toomuchosteoclastcellactivitycanresultinbonethinning.asmentionedbefore,omega-3shaveshowntotobeveryeffectiveanti-inflammatoryagents.studiesshowthatepaanddhatonedowntheinflammatorysignalingthatcausestheosteoclastcellstoactivate.thiseffectivelysendstheosteoclastsawayandpreventsexcessiveboneloss.what’smore,epaanddhaincreasetheproductionofthebone-buildingcells,osteoblasts,helpingcounteracttheeffectsoftheirbone-removingcounterparts.thisallsoundsgreat… sohowmuchomega-3fattyacidsdoineed? nowthatwe’veestablishedallofthepotentiallyamazinghealthbenefitsthatareassociatedwithomega-3sandthepossiblerepercussionsofnotgettingenoughthroughdiet,howdoesonereapsaidbenefits?mostmainstreamhealthorganizationsrecommendconsuming1.1–1.6gramsofalaandaminimumof250–500mgcombinedepaanddhaeachdayforhealthyadults.theamericanheartassociationsuggeststhatpatientswithheartdiseaseconsumeabout1gramcombinedepaanddhaeachday,whilethosewithelevatedtriglyceridesshouldtrytoget2to4gramsperday. wheretogetomega-3fattyacidsasaplant-basedeater.  thosewholivetheirlivesasplant-basedeaterswillinevitablyhaveatoughertimegettingcertainomega-3sintotheirdiets.knowingwhatoptionsareavailableandwheretofindthemcanmakeiteasiertocomeupwithasolution. alasourcesalaisfoundinfoodssuchasflaxseeds,flaxseedoil,canolaoil,chiaseeds,walnuts,hempseeds,andsoybeans.thesearerelativelyeasysourcesforaplant-basedeatertofindandaddintotheirdiet,butwhatabouttheothertwoimportantomega-3s?asstatedearlieron,alaconvertsintoepaanddha,’smostdefinitelynotasufficientamounttoberelyingsolelyonalaasoursourceofomega-3s. dhaandepasources  dhaandepaarethemoredifficultomega-3stoobtainonaplant-baseddiet.themostwidelyacceptedandaccessiblewaytoincorporatethesetwoessentialfattyacidsarethroughfishandfishoil.butwheredoesthatleaveplant-basedfolks?luckily,thesearenottheonlysourcesofdhaandepa.fishconsumemicro-algaeandothermarineplants,andthesespeciesofseaweedaretherootsourceofhigh-qualityepaanddha.thosecompoundsarethendepositedinthefish’sfatdeposits.that’swhythoselookingforasupplementalsourceofomega-3’’snotthatfishuniquelyproducedhaorepa;it’sthattheyeattheseaweedthat’srichintheseomega-3s.sonowyoumaybethinking,“ilovesushi!i’lljustfindwaystoaddabunchofseaweedintomydiet.”butbecauseseaweedsaresolowinfat,theyproviderelativelylowamountsofepaanddhapergram.soyouwouldhavetoeataharrowinglylargeamountofseaweedeverysingledayinordertoreapanyomega-3benefits.practicallyspeaking,mostpeoplecan’torwon’tdothat.that’swhyitisstronglysuggestedthatplant-basedeatersconsiderwaystosupplementtheirintakeofdhaandepa. ifyouneedanomega-3supplement,here’swhattolookfor… luckily,therearenowalgae-derivedomega-3supplementsavailableforthosewhofollowaplant-baseddiet.wecancutoutthe“middlefish”entirely,dotheplanetafavorandgostraighttothesource.whenlookingatyouroptions,considerthosewithawidevarietyofomega3’s,ratherthanthosewithjustone.whileeachomega-3hasitsownsetofuniquebenefits,theyalsosupporteachotherinkeepingourbodiesfunctioningsmoothlyonadailybasis.themorethemerrier.alwaysmakesureyouaregettingahighqualityproduct,it’llbegoingintoyourbodyafterall.doyourresearchandchecktoseeiftheproducthasbeentested,andifso,thatitwasdoneinfdaregisteredfacilitiesoperatingundercgmpstandards.youwanttomakesurethatwhatyou’rebuyinghasaccuratepotencyandhaspassedinspectionforunwantedcontaminantssuchasheavymetalsandbacteria.nowthatyou’vehadtherundownofallthingsomega-3,youcandecidewhetherornotit’sworthmakingthe(notsostrenuous)efforttoincludethemintoyourdiet,andhowyoudoit.don’tforgettotakeintoconsiderationyourpersonallifestyle,dietaryrequirements,andhealthfactors.   referencesthe3mostimportanttypesofomega-3fattyacids.,1feb2003vol:23,number2.,2015,breastcancerresearch,article62.ω-3polyunsaturatedfattyacids,4nov2013. polyunsaturatedfattyacids:whatistheirroleintreatmentofpsychiatricdisorders,23oct2019. therolesoflong-chainpolyunsaturatedfattyacidsinpregnancy.‐3polyunsaturatedfattyacidsandinflammatoryprocesses,5feb2013. omega-3fattyacidsupplementationfor12weeks,17dec2015.,contaminants%20on%20the%20developing%20fetusomega-3fattyacidsandhearthealth,1dec2015,vol132,number22.

The Lowdown On Omega-3s — How Important Are They For Plant-Based Eaters?

+Read article

Decadent Plant-Based Zucchini Brownies
decadentzucchinibrownies(withaveggiesurprise)by:complementthismightjustbeoneofthebestwaystosneakyourveggiesin.ifyouhavekids,they’llneverhavetoknow–itcanbeyourlittlegreensecret.justbecauseit’sadeliciouslydecadentandchocolateybrowniedoesn’tmeanitcan’thavesomehealthyelementstoit.thisrecipehaslesssugarthanmostotherbrownierecipes,hasoveracupofzucchinihiddeninit,hasahealthyamountoffiber,andjustsohappenstobeglutenfree.goaheadandindulge-leavingbehindallunnecessaryguilt!ingredients: dry:1½cuprolledoats½cupcocoapowder1teaspoonbakingpowder¼teaspoonbakingsoda½teaspoonsalt½cupdairyfreechocolatechipswet:½maplesyrup1¼cupshreddedzucchini(drainedandtightlypacked)½cupnutbutterofchoice¼cupplant-basedmilk1teaspoonvanillaextract directions linea6x9panwithparchmentpreheatyourovento360fprocessalldryingredients(exceptchocolatechips)inafoodprocessoruntilpowderedaddallwetingredientsandblendagaintilbatterissmoothstirinchocolatechipspourbatterintopanandsprinklewithmorechocolatechipsbakefor30-35minutesforfudgybrownies,and40minutesforamorecakeybrownieletbrowniescoolcompletelybeforeattemptingtocut.theywillfirmupastheycool.*protip:replacehalftheamountofcocoapowderwithcomplementchocolateproteinforalittleproteinkick!recipeby:

Decadent Plant-Based Zucchini Brownies

+Read article

No-Bake "Candy Bar" Recipe
no-bake"candy-bar"recipeby:complementthisparticularhealthytreatrecipetakesinspirationfromadeliciouslysweetcandybarthat’sanamericanstapleandrhymeswiththeword“flickers”.emulatingthetexturesofachewynougat,andasoftgooeycaramelfillinggetthishealthyalternativefairlyclosetotherealdeal.andwhileitmaynotreachthesamelevelofcandy-sweetdecadenceastheprocessedversion,it’sstilldelectablytastyinitsownright.ingredients: forthegooey“caramel”:1packedcuppittedmedjooldates2tablespoonscreamypeanutbutter1teaspoonvanillaextract1/4teaspoonsaltforthe“nougat”:1/4cupofyourfinisheddate“caramel”2/3cupoatflour(opt.replacehalfwithcomplementchocolateprotein)forcoating:1/2cupdryroastedpeanuts8ouncesplant-basedchocolate directions inalargerbowlcoverthedateswithhotwaterandsoakfor5-10minutes.drainthedates,squeezingthewateroutgently,andreservethewater.lineabakingsheetorcoolingrackwithparchmentpapertoplacethecompletedbarsonlater,setaside.alsolinealoafpanwithparchmentorplasticwrap.makethecaramel:adddatestoyourfoodprocessorwithpeanutbutter,vanilla,andsalt.processuntilthickandsmooth,scrapingthesideswhennecessary.ifthemixtureistoothick,addinthereserveddatewaterin1tablespoonincrementsuntilyougetanevenlysmoothmixture.makethenougat:removethedate“caramel”fromthefoodprocessor.addtheoatflour(andoptionalcomplementchocolateprotein)tothefoodprocessor(noneedtorinse)with1/4cupofyourdate“caramel”andprocessuntilsmooth.assemble&freeze:firmlyandevenlypressthe“nougat”intoyourlinedloafpan.useaspatulatospreadtheremaining“caramel”evenlyoverthenougat,thensprinklethepeanutsontop.useyourfingerstopressthepeanutsintothecaramellayer,sotheystick.placethisinthefreezerfor60to90minutes,untilfirm.removethefrozen“filling”fromitscontainer,thenuseasharpknifetocutitintobar-sizedpieces.returnthesetothefreezerwhileyoumeltyourchocolate.meltyourchocolate:placeyourchocolatepiecesinaglassbowlandmicrowaveat30secondintervals,stirringinbetween.oncethechocolateisaround80%melted,stopmicrowavingandstirthemixturewithaspatulauntilcompletelymelted.chocolatecoat:movingquickly,place1frozencandybarintothebowlofmeltedchocolate.usetwoforksto“flip”thebar,untilitiscoatedinchocolateonallsides.removethebarfromthemeltedchocolate,lettinganyexcesschocolatedripoff.then,placeitontothepreparedbakingsheetandrepeatwiththeremainingbars.placethebarsinthefridgefor5to10minutes,toallowthechocolatetoharden.serveandenjoy!barsarebeststoredintherefrigeratorandwilllastthereforupto10days.youcanalsoplacetheminthefreezer,wheretheywilllastforuptoonemonth–justletthebarsthawfor5orsominutesbeforeenjoying.recipeby:

No-Bake "Candy Bar" Recipe

+Read article

Whole Wheat Pumpkin Spice Snickerdoodles Recipe
wholewheatpumpkinspicesnickerdoodlesby:complementwhatisfallwithoutalittlepumpkinspice?doesitevencount?thissimple,healthiersnickerdoodlerecipeistransformedtoadistinctlyfallcookiewithaswitchfromtheconventionalcinnamontopumpkinspice.thearomasthatwillfillyourhomewhenyoubakethesearelikeawarmandcozyhugfromtheseasonitself.whoneedsapumpkinspicecandlewhenyoucangettherealthing,andhavesomedeliciouslyfestivecookiestoshowforit?ingredients: cookiedough:1cupwholewheatflour(orgluten-freeflour)¾teaspooncreamoftartar½teaspoonbakingsoda½teaspoonpumpkinspice¼teaspoonsalt2tablespoonalmondbutter1flaxegg2teaspoonsvanillaextract½cupbrownsugar(orcoconutsugar)coatingtoroll:¼cupbrownsugar(orcoconutsugar)1tablespoonpumpkinspice directions topreparethecookies,whisktogethertheflour,creamoftartar,bakingsoda,pumpkinspice,andsaltinamediumbowl.inaseparatebowl,whisktogetherthealmondbutter,flaxegg,vanilla,andsugar.addintheflourmixture,stirringuntilincorporated.chillthecookiedoughfor30minutes.topreparethecoating,mixtogetherthebrownsugarandpumpkinspiceinasmallbowl.preheattheovento350°f,andlineabakingsheetwithparchmentpaper.usingaspoon,dropasmallamountofthecookiedoughintothecoatingandrolltocoat.oncefullycoveredincoating,rollthecookiedoughintoaballbetweenyourpalms,andplaceitonthepreparedbakingsheet.repeatwiththeremainingcookiedoughandcoating.flattencookiedoughballsveryslightlytogiveaheadstarttospread.bakeat350°ffor9-11minutes.letthecookiescoolonthewarmbakingsheetforatleast10minutesbeforetransferringtoawireracktocoolcompletely.devour!recipeby:

Whole Wheat Pumpkin Spice Snickerdoodles Recipe

+Read article

Plant-Based Mole Negro Recipe (With Protein Boost)
plant-basedmolenegrorecipeby:complementmoleisadelictiblycomplexandrobustsaucethatcomesinmanydifferentstyles.dependingonwhoismakingitforyou,who’sgrandmothertaughtthem,andwherethatgrandmothergrewup,theingredientscanvarygreatly.thisversionisonethatwasgiventomebyafriendwhosegrandmotherwasfromoaxacaandwouldbeconsideredamolenegro.however,withtheflexiblenatureofthisrecipe,youcanfeelfreetosubstitutemanyingredients,suchasthenuts,seeds,chilis,anddriedfruit,toyourpersonalpreference–orthelimitationsofyourcurrentpantrycontents.ifyoumakemorethanonebatch,’sdeliciouspouredoverpracticallyanything(includingthistamalerecipe),butparticularlygreatoverheartyroastedvegetableslikesweetpotatoesorfallsquash.ingredients: 3driedchipotlechiles,stemmedandseeded2driedguajillochiles,stemmedandseeded2driedanchochiles,stemmedandseeded2cupsrichvegetablebroth1slicebread,tornintopieces2corntortillas,chopped5tomatillos,cutinhalf2tomatoes,cutinhalf1tablespooncoconutoil1onion,thinlysliced½headgarlic,peeledandchopped⅓cuppeanuts,chopped1tablespoontoastedsesameseeds⅓cupraisins1/2tablespoongroundcumin1tablespoondriedthyme1teaspoongroundallspice1/2teaspoongroundclove1teaspoongroundcinnamon1cuprichvegetablebroth1tablespooncocoapowder3tablespoonscomplementchocolateprotein(or1moretablespooncocoapowder)2tablespoonsbrownsugar1teaspoonsalt directions toastchipotle,guajillo,andanchochilesinadrypanovermediumheat,stirringconstantly,untilwarmandaromatic,about3minutes.transfertoablender.heat2cupsvegbrothinasaucepanuntilitbeginstosimmer,about5minutes.pourbrothintotheblender.toastbreadpiecesandtortillapiecesinadrypanovermediumheat,stirringconstantly,untilbrowned.transfertotheblenderwithbrothandchiles.allowthechiles,toastedbread,andtortillastosoak,fullysubmerged,inthebrothuntilsoftened,about10minutes.blendthemixtureuntilsmooth.cooktomatillosandtomatoesinadryskilletonmedium-highheatuntilsoftandcharredoneachside.placetomatoesintheblenderwiththechilepuree.meltcoconutoilinalargeskilletovermediumheat.stirinonion,garlic,peanuts,sesameseeds,raisins,cuminseeds,thyme,allspice,clove,andcinnamon;cookandstiruntilonionsaresoftandgolden,5to8minutes.addonionmixturetotheblenderwiththechile-tomatomixtureandblenduntilsmooth.pourchilepureeintoalargesaucepanovermediumheat.stirin1cupvegbroth,cocoa,chocolateprotein,sugar,andsalt.bringmixturetoasimmer;stiruntilalliscombinedandsauceisthickenedandslightlyreduced,10to15minutes.recipeby:

Plant-Based Mole Negro Recipe (With Protein Boost)

+Read article

Fiery Spiced Jackfruit Tamales
spicedjackfruittamalesrecipeby:complementtamalesarethoughtofasbeingacomplicatedandtime-consuminglaboroflove,butitreallydoesn’thavetobe.thismisconceptioncomesfromthefactthattamalesareusuallymadeinhugequantities,tobesharedwithlarge,orevenmultiplefamilies.youdon’thavetomakesuchabigproductionifyouarecookingforamodestamountofpeople.thenagain,ifyoudowanttomakethistosharewithallyourfriendsandfamily,byallmeans!tamalesareoneofthosemagicalfoodvesselsthatcancarryanumberofdifferent,delectablefillingsinside;fromsweetcorn,topoblanos,totempeh.inthisrecipeweareusingafiery,spicedjackfruitasourfillingofchoice.ingredients: tamaledough:~25-30cornhusks4cupsmasaharina3-3½cupsvegetablebroth½cupoliveoil1teaspoonbakingpowder½teaspoonsalt¼teaspoonturmericspicedjackfruitfilling:40ozjackfruit,chopped(cannedorfresh)1tablespoonoliveoil1yellowonion,sliced4clovesgarlic,minced½cupvegetablebroth1tablespoonagave/maplesyrup½lime,juiced2teaspoonchilipowder1teaspooncumin1teaspoonsmokedpaprika½teaspoonsalt3tablespoonscomplementunflavoredprotein(optionalproteinboost) directions forthehusks:separatethecornhusksandsoaktheminalargebowlofhotwaterfor30minutesto1hour,oruntilpliable.drain.riponeortwoofthecornhusksintothin(1/4″)stripsandusetheselatertotiethetamalesshut.forthejackfruitfilling:heatoliveoiloverlowheatandaddinonionsandgarlic,stirringuntilslightlysoft.addinthecumin,chilipowder,andsmokedpaprika,,,addinthevegetablebroth,agave,limejuice,andoptionalcomplementproteinandbringtoaslightsimmer.stireverythingtogetherandlettheliquidcookoutuntilit'sanicejuicyconsistency.forthedough:inalargebowl,addinthemasaharina,bakingpowder,salt,andturmeric.mixtogetheruntiluniform.pourin3cupsofvegetablebroth(tostart)andthe1/2cupofoliveoil.mixuntilwellcombined,addingmoreliquidasneededsothatthedoughisspreadable(about1/2cupmore).toassembleeachtamale,spreadabout3-4tablespoonsofthemasamixtureonthecenterofthecornhuskto1/4to1/2inchthickness(dependingonyourpreference).place2tablespoonsofthefillingintothecenter.foldinandoverlapbothsidesofthehuskandthenfoldupthebottom.tieyourtamalesshutwiththehuskstripsyoucutearlier.placethetamalesopensideupintoalargesteamerbasket.addwatertoalargesteamerpot,belowthebasket,andbringittoaboil.reduceheattolowandcover.steamthetamalesfor1hour,beingsuretoaddwatertothepotwhennecessarytopreventburning.toeat,removehottamalesfromhusksandenjoywithyourtoppingsofchoice(likethisdeliciousmolerecipe)!tostore,letthemcoolintheirhusksbeforerefrigerating.recipeby:

Fiery Spiced Jackfruit Tamales

+Read article

Decadent Coconut Tres Leches
decadentplant-basedcoconuttreslechesby:complementwhoneedscakewithaglassofmilkwhenyoucanhavecakesoakedinthreetypesofyummyplant-basedmilksinstead?inthiscase,ourthreemilksofchoicearecoconutmilk,coconutcream,andoatmilk,however,youareobviouslyfreetousewhateveryouhaveonhand.theresultisanimpossiblymoistandsilkysmoothtreatwithalightcoconutflavorandjustahintofcinnamon.thiscoconuttreslechesisgreatforanytimeofyearandpairswonderfullywithwhateverfreshfruithappenstobeinseason.shareitwithyourfriendsandfamilyorkeepitallforyourself!ingredients: forthecake:1½cupsunsweetenedcannedcoconutmilk2teaspoonsapplecidervinegar2cupsallpurposeflour(orgluten-freeflour)2tablespoonscornstarch¾cupgranulatedsugar2teaspoonsbakingpowder¼teaspoonbakingsoda½teaspoonsalt⅓cupmeltedcoconutoil(ortahini)2teaspoonspurevanillaextractforthesoakingmix:½cupcoconutmilk1cancoconutcream½cupplant-basedmilkofchoice1tablespoongroundcinnamonforthewhip:1cancoconutcream(pre-chilledovernightinfridge)½cuppowderedsugar(ifcoconutcreamisunsweetened) directions makethecake:preheattheovento350degreesfandgreasea9×13inchcakepan.combine11/2cupscoconutmilk,vinegar,meltedoil(ortahini),andvanillainameasuringcuporbowl.inalargebowl,whisktogethertheflour,cornstarch,sugar,bakingpowder,bakingsodaandsalt.nowpourinthecoconutmilkmixture.whiskuntilcombinedandtherearenolargelumpsleftinthebatter.pourthebatterintothecakepan,transfertotheovenandbakefor20-25minutes,untilatoothpickinsertedinthecentercomesoutclean.removefromtheovenandletthecakecoolforabout15minutes.thecakeshouldstillbewarmwhenyoupourthemilkoverit;itwillabsorbbetter.makethesoakingmixture:scoop/pourthefullfatcoconutmilkintoalargemicrowavesafebowl.heatfor1minute,untilwarmandtherearenomorehardwhiteportions.addthesweetenedcondensedcoconutmilk,oatmilk,andcinnamontothebowlwiththecoconutmilkandwhiskwell.soakthecake:useaforktopokeholesalloverthetopofthecake,allthewaydowntothebottomofthepan.slowlypourthemilkmixtureoverthecake.refrigeratethecakeforatleastanhourtoletitsoakupthemilk.makethewhip:chillabowl(preferablymetalorglass)inthefridgeforatleast15min.takeyourcanofcoconutcreamoutofthefridge,openitup,andseparatethefirmcreamintoyourchilledbowl,savingtheliquidontheside.siftyourpowderedsugaroverthechilledcoconutcream,andstartwhipping!whipuntilyou’vereachedafluffyconsistency.ifyouneeditabitlighter,addafewdropsoftheseparatedliquidandwhipmore.chillfinishedwhippedcreamfor30minutesbeforetoppingoffyourcaketoenjoy!recipeby:

Decadent Coconut Tres Leches

+Read article

Vegan Banana Protein Granola Recipe
bangin'bananaproteingranolarecipeby:complementriddletime:whatcomesasabar,mixesintocereal,tastesgreatondessert,andisperfectonitsown?youguessedit,granola.andtodaywehaveasimple,elevatedgranolarecipethattakesjust5minutestoprepbutpackslotsofflavorandprotein.unlikemoststore-boughtgranolasthatareloadedwithsugarandoil,thisrecipeutilizesrealfoodingredients:bananatobindeverythingtogether.maplesyrupforhintofsweetness(optional).complementproteinforanextraservingofprotein.checkouttherecipe,here:bangin'bananaproteingranola ingredients:wetingredients:1/4cuptahini1ripebanana,mashed2tspvanillaoptional:ifyoulikeitabitmoresweet,add1/4cupmaplesyrupdryingredients:2.5cupsrolledoats1/2cupcoconutshreds/ribbons1/2cuppumpkinseeds1/4cupwalnuts,chopped2tbspcinnamon3tspofcomplementprotein1/2tspsaltadd-insafterbaking:1/2cupraisinsordriedcranberriesorchoppeddates1/4cuphempseeds directionspre-heatovento325f.mixthewetingredientstogetherinalargebowl.addthedryingredientstothewetandhandmixthoroughly.layitoutevenlyonaparchment-coveredpan.bakefor16minutes,mixingaroundhalfwaythrough.(carefulnottoletitburnattheend!)removefromtheovenandletcoolcompletelybeforestoringitinanairtightcontainerinyourcupboardorthefridge.asyoutransferittoyourcontainer,addintheadditionalingredientsandshakeitup.recipeby:

Vegan Banana Protein Granola Recipe

+Read article

Stop trusting supplement companies (I know, I’m the founder of a supplement company)
stoptrustingsupplementcompanies(iwouldknow,i’mthefounderofasupplementcompany)by:matttullman,co-founderinthefiveyearssincewestartedcomplement,thisisthehardestblogposti’veeverhadtowrite.isaythatbecause,afterallthetypicalupsanddownsastartupgoesthrough,we’vefinallyreachedapointwiththecomplementbusinessthatresemblesstabilityandcomfort.butcomfortwasneverthereasonwestartedthiscompany.andastemptingasitistojustnotrocktheboat,that’snothowwemakeprogressandimprovetheworld.iknowthisisgoingtoupsetalotofourpeersinthesupplementindustry,andmaybecostourcompanysomeallies.buti’mokaywiththat,becauseidon’tfeellikeihaveachoice.soheregoes.infiveyears’time,we’veseensomescaryandsadillustrationsofthedeceitthatisrampantinthesupplementindustry.justafewexamples:wehadamanufacturersuggestthatitwouldbealrightforustodelivervitaminsinamountsthatare50%lessthan“labelclaim.”(thatmeansourcustomerswouldgethalftheamountofthenutrientsweclaimedonourpackaging,andwe’dsaveabunchofmoneywiththislie.)welearnedwhysomanycompaniesuse“proprietaryblends”whenasuppliersuggestedthatwedoitwhenwewerecreatingcomplementprotein.(proprietaryblendsallowacompanytocreateaproductthat’s97%acheapingredient,1%eachofthreegoodingredients,andthenlistthefouringredientswithouttellinganyonethepercentages.customersthinktheyhaveamagicformula,whenwhatthey’repayingforisabigcharade.)we’veconsistentlyheardthataslongasafilleringredient,orpreservative,orsomeotherscarythingis“under2%oftheformula”thatwedon’tneedtolisttheingredient,orevenmultiplesuchingredients.thelistgoeson…whichiswhysupplementcompanieshave—fromwhatwe’veseen,awelldeserved—badrap.(wehopeitgoeswithoutsayingthatwedidn’tactuallydoanyofthesethings.)thesupplementindustrywantstosellyoucocktailsofvitamins,minerals,andothercompounds.that’stheirendgoal—theirreasonforbeing.sellingmore.attheendoftheday,theydon’tactuallycareifyougethealthy.aslongasyoukeepbuyingvitamins,they’rehappy.that’salwaysbuggedus.ourchoicetocallourselves“complement”(crossingouttheword“supplement”)wasanodtothisdiscomfort.when“supplementcompanies”survivebysellingyoumorethanyouneed,wewantedaproductwithonlywhatweneededandnothingelse.wewantedtomaketheproductthatwewantedtotake—andtogivetoourfamilies,includingouryoungkids.that’showcomplement—theproduct,andthename—cameabout.butlikeitornot,whenitcomesdowntoit,weareinfactasupplementcompany.evenifwethinkofourselvesdifferentlyandourcustomersthinkofusdifferently,tosuppliers,competitors,andtherestoftheindustry,we’reasupplementcompany.likeisaid,thishasalwaysbotheredus,butwe’vedoneourbesttoplaythegameinawaythatstaystruetoourvalues,ethics,andmissiontosupporttheplant-basedmovement.butwe’vecometotheconclusionthatthere’smorewecando.moreforyourhealth,moreforthehealthofthemovement,andmoretoempoweryoutomaketherightdecisionsforyourgoals.doyouknow(forsure)ifyoursupplementworks?alotofpeopletakesupplementstofilltheholesintheirdiets.butthefactisalotofpeopledon’tknowwhetherthesupplementstheytake(andpayhandsomelyfor)actuallymakeadifference.weconfirmedthiswiththesurveywesentouttoourcommunitylastweek.onestrikingfact,asanexample:whileabouthalfofrespondentsdooccasionallygettheirvitaminb12anddlevelschecked,onlyabout10%ofpeoplechecktheirlevelsofdhaandepa,twoomega-3sthatarecriticalforbrainandhearthealth.butwhatweasasupplementcompanyknowisthis:relativetob12,d,andmostothernutrients,omega-3’sareveryexpensive,sothey’rethenutrientmostlikelytobeunder-providedinasupplement,inordertokeepthepricedown.eventhoughcomplement’somega-3contentisthehighestofallveganmultivitamins,wewishwecouldincludemore.buttodosowouldmeanraisingthepriceandgoingfromthreecapsulestofour,andifweweretodothat,itwouldbecomeinaccessibletoalotofpeople.evensomecomplementsubscribers—membersofourteamincluded—haveomega-3levelsthat,whileinapassablerange,aren’tquiteoptimal.noteveryone,ofcourse,asdietandindividualconversionratesofotheromega-3’salsoplayarole.butasmuchaswe’dlovetomakeaone-size-fits-allsupplement,it’sjustnotpossible.andwhatdoyouthinkmostsupplementcompaniesdowithinformationlikethis?(trustme,theyhaveit.)right.theyhideit.oratleastdon’ttalkaboutit.becausethegoalistosellyoumoresupplements,nottomaximizeyourhealth.thesupplementindustryisalltoohappyforyoutoliveinblissfulignorance,choosingtobelievethatwhatyou’redoingisworkingtopreventdeficienciesorhelpyoufeelalittlebettereachday.sohowaboutyou?doyouactuallyknowthatthesupplementsyou’repayingforareworking?fromwhatwe’veseen,theoddsaregoodthattheanswerisno.whoseresponsibilityisyourhealth?withsomethingasimportantasourhealth,whydon’tmoreofusfeeltheresponsibilitytomakesurethatwhatwe’redoingisworking—beyondjustsubjectivelynotinghowwefeel?well,therearealotofreasons,andfortunately,noneofthemisyourfault.first,wewereraisedtobelievethatourhealthwasn’tourresponsibility.itwastheresponsibilityofourdoctororourparents,ourgenetics,orsomethingelsebeyondourcontrol…anythingbutourownresponsibility.ourculture,unfortunately,nevertaughtusthatit’sourprivilegeandresponsibilitytomakethedecisionsthatallowustothrive.thentheinternethappened,andwebecameprivytolotsofinformationthatallowedustotakemorecontrolofourownhealthdecisions(likethatoneabouteatingaplant-baseddiet…).exceptthenalotofusstartedjustlisteningtosocialmediaexperts,googleandwebmd,andabunchofothercompanies.companieswho,likei’vesaid,don’tnecessarilyhaveyourbest,long-termhealthinterestsatheart.butitgetsworsestill.whileyou’rededicatedtobeinghealthy,awholelotofpeople(unfortunately)aren’t.andwhiletakingstepstopreventhealthproblems(likeyouprobablydo)isrelativelycheap,treatingthemaftertheyariseisexpensive.butourhealthcaresystem,withitsover-relianceonretroactivefixespaidforbyinsurancecompanies,doesn’tproperlyincentivizeprevention.soitcostswaymorethanitshouldforyourdoctortoorderbloodtestsforyou.oh,andstatistically,yourdoctorprobablyisn’tplant-based,sincedespitealotofgrowthoftheplant-basedmovement,we’restillavastminority.soevenifyoudidwanttoaskforsomebloodtests,heorshemightnotknowexactlywhichonesyoushouldget…norhowtointerprettheresultsthatcomeback.forexample:dothe“normal”rangesapplywhenyourdietisplant-basedandyourlifestyleisactive?oraretheymadeforsedentarypeople?andasfortheirguidancetocorrectabnormalitiesintestresults…we’renotdoubtingthattheymeanwell,butsooftenatypicaldoctor’srecommendationsjustaren’ttailoredtosomeoneforwhomeatingplant-basedisbothahealthchoiceandanethicalone.(ifihearonemoretimethatishouldtryeatingmoresalmonandyogurt…)ihavetalkedtomostofourteamaboutthis—andplentyoffriendsandfamilyandourcommunity—andeveryonesaysthesamething:“iwishitwereeasier,andlessstressful,andlessexpensivetodothehealthteststhatiknowishoulddo.”butbecauseitinvolvesthedoctor,insurance,waitingrooms,time-wastingandhighcostsallaround—nottomentiontheresearchtounderstandwhatteststoaskforandhowtointerpretthem—peopledon’tdoit.andthat’satragedy.becausethesolutionto“testingisinconvenientandexpensive”shouldn’tbetoremaininthedarkaboutwhetherthesupplementsyou’repayingforareworking—and,really,whetheryourdietandlifestylearekeepingyouhealthy(notjustfeelinggoodnow,butprotectingyouforthelongterm).tochoosethelatter—todonothing—issimplyreplacingonecostlyproblemwithonethat’sevenmorecostly,intheformofsupplementsyou’repayingforthatareultimatelyfindingtheirwayintoveryexpensiveurine.orworse,toignoreahealthissueuntilit’stoolateandcostsevenmoretotrytotreatorreverseit.thegoodnews?there'spotential.(lotsofit.)thesesystemicproblemshavekeptusupatnightforalongtime.butnotbecausewefeelhopeless.infact,it'sbecausewefeeltheexactopposite—excitedtofixaproblemandserveyou,ourcommunity,inevenmoreways.ifwe(asasociety)havebeensomisledbysupplementcompaniesandunder-informedfromlackoftesting,justthinkaboutthepotentialwhenthisisnolongerthecase.itwouldbelife-changing.wewouldn’tjusthopewe'retakingtherightactionsforyourlong-termhealth,we’dknow.ifashort-termissuearises,we’dhaveinsightonhowtoaddressit.inrealtime.that’sreallypowerfulbecause,asthe(true)clichégoes,anounceofpreventionisworthapoundofcure.andmaybemostimportantly,we'dhaveaclearactionplanforhowtogainenergy,thinkmoreclearly,feelyourbest,andunlockoptimizationwemaynotevenknowtobepossible.itsendschillsdownmybackjustthinkingofthepotential.butrightnow,that’sjustpotential.notyetreality. areyouwithus?complementexistsbecausewecouldn'tfindatransparent,trustworthysourceofnutrientstobalancethehealthydietsofourselvesandourfamilies.asaresultofthiscommitmenttotrust,we’renowprivilegedtoserveanamazingcommunityofpassionatepeoplewhobelievethefutureoffoodisplant-based.andnowwewanttobringyou,ourcommunity,alongwithusonournextevolution,onethatsolvestheproblemsi’velaidoutinthisblogpostbyputtingeveryphaseofthetestingprocess—thedecisionsaroundwhattotestfor,thein-hometestingitself,thecarefulinterpretationofresultsfortheplant-basedconsumer,andpersonalizedguidanceforwhattodowiththoseresults—inyourhands.wedon’twanttosellyousupplements.instead,wewantyoutobehealthy.that’sthemottoaroundwhichwe’regearingeverydecisionwemakeaswebuildthenextiterationofourcompany.we’recallingthisnewfocus“personalized,evidence-basednutrition.”andifwe’resuccessful,thepotentialforyourhealth(andthismovement)ismassive.wedon’tyethavedetailstosharejustyet;thiswholethingistoonew.wewanttoknowifwe’realigned,iftheproblemswe’veidentified(withyourhelp)aretheonesthatkeepyouupatnight,too.andifyou’rewithus.we’vegotsomeworkaheadofus.somedeepthinking,awholelotofconversationswithcommunitymembers,andplentyofbuilding.butit’llbeworthit,andwe’resogratefultohaveyouwithusonthejourney.

Stop trusting supplement companies (I know, I’m the founder of a supplement company)

+Read article

Vegan Proffee Recipe
theultimateplant-basedproffeerecipeby:matttullman,co-founderproffee(proteincoffee...getit?),ahomemadedrinkcombiningproteinpowderorshake,milk,andcoffee,hasbeenmakingwavesacrosstheinternet.amorningboostofproteincouldhelpyoumeetyourmacronutrientgoalsandevenloseweight...butwecouldn'thelpbutnoticeaglaringproblemwithmanyoftheproffeerecipesoutthere:theproteinshakesandpowderscommonlyusedarefilledwithingredientsyoudonotwanttokickoffyourdayconsuming.(orendyourdayconsuming,forthatmatter.)soiaskedourleadrecipedeveloperifwecouldcreateabetterproffee—oneicouldgetexcitedaboutdrinkingmyself.andasitturnsout,aclean,plant-basedproteincoffeeissupereasy.theultimateplant-basedproffeerecipe: brewcoffeeorespresso.frothyourplantmilkofchoice(wepreferoat).whiskcomplementprotein(unflavoredorchocolate)intothecoffeeandpouronplantmilk.sprinklecinnamonforaddedenjoyment.(watchtherecipeinactionontiktok,here.)that'sit!youcanevenserveithotorcold.

Vegan Proffee Recipe

+Read article

How to Improve Your Gut Microbiome
howtoimproveyourgutmicrobiomewithdahliamarin,rdn,ldandjamesmarin,rd,en[part2]by:dahliamarin,rdn,ldandjamesmarin,rd,enofmarriedtohealthwantinonanunfortunatesecret?eatingaplant-baseddietmaynotbeenoughwhenitcomestoyourguthealth.andthismattersbecauseahealthygutmicrobiomeislinkedtoeverythingfromimmunityandmoodtobrainfunction,energy,andfeelingyourbest.(checkoutpart1ofourinterviewwithmatttullmanformoreontheconnectionbetweengutandlong-termhealth.) asregistereddietitiannutritionistswhospecializeinguthealth,nearlyeverydaywehearfrompatientsconfusedorfrustratedthattheirfiber-rich,plant-centereddietisn'tgivingthemtheresultstheyexpected.sowhatgives?atthecenterofahealthygutisalwaysgoingtobewholeplantfoods.plantsarerichinhealthyinsolublefiber,whichpassesthroughyourdigestivetract,actingasaprebioticbyfeedingthegoodgutmicrobes.but—andhere'sthekicker—thereareanumberofthingsthatcouldderailthisprocess.wegointoallthedetailsinpart2ofourinterviewwithmatt,whichyoucanwatch,here:notesfromtheinterview:5reasonswhyyouryoumighthaveguthealthissues 1)youdon'teatenoughplantvariety.justbecauseit'saplantfooddoesn'tmakeitgoodforyourgut.that'swhywelabeleverythingasagoodgutfood—likewholegreens,veggies,beans,andwholegrains—orasometimesfoodslikefriedfoods,processedfoods,etc. evenwithahealthydoseofgoodgutfoods,diversityiscriticalforahealthygutmicrobiome,withtheamericangutprojectrecommendingyouconsumeatleast30differentplantfoodseachweekforimprovedguthealth. 2)youdon'tgetenoughsleep.sleepallowsyourgutmicrobiometorest,repair,andrejuvenateeachdaysotheycancontinueworkingandfunctioningproperly. 3)you'renotexercisingenough.moderateexercisecandecreaseconstipationandbloatingbysupportinggutmovementandmotility. 4)youdrinktoomuchcoffee,tea,oralcohol.aswithanything,,whole-leafmatcha,greenteas,andevencoffeecanbebeneficial.alcohol,whilenotahealthfood,canalsobeanenjoyabletreat.butifthey'recausingyoudigestiveissuesorstressliketheydoformanypeople,allthreemaybecontributingtoanimbalanceinyourgut. 5)you'restressed.stresscantakeamajortollongoodgutbacteria,withstudiesshowingthat40-60%ofthosediagnosedwithirritablebowelsyndrome(ibs)havealsobeendiagnosedwithanxiety.there'salothere,andreadingthroughthislistmaysoundabitdisheartening.thegoodnewsisthateatingplantfoodsareandalwayswillbethefoundationforguthealth...andifyoucanoptimizetherestofyourlifestyle,you'llbegintounlockincredibleshort-termcomfortandlong-termhealthbenefits. 

How to Improve Your Gut Microbiome

+Read article

How Gut Friendly Is Your Diet?
howgutfriendlyisyourdiet?withdahliamarin,rdn,ldandjamesmarin,rd,en[part1]by:matttullman,co-founderifyouknowanythingaboutguthealth,it'sprobablythis:plantfoodsarethebestwaytodiversifyyourmicrobiomeandimproveyourguthealth.soasaplant-basedeater,you'vealreadydonethehardestpartbyaddingabunchofplantstoyourdieteachday.butisitreallyassimpleaseatingplants?notexactly.todigdeeperintoeverythinginvolvedinoptimizingyourguthealth,iwentstraighttotwooftheleadingguthealthspecialists,dahliamarin,rdn,ldandjamesmarin,rd,en.theyworkwiththousandsofclientseveryyearthroughtheirpracticeatmarriedtohealth,andtheyknowexactlyhowtoensureyourdietisworkingforyourgut(andyourhealth).thisisthefirstofatwo-partinterviewwithdahliaandjames,andinthisconversation,wecover:whatguthealthisallabout(andwhyyoushouldcare)howtoknowifyourgutisunhealthythelinkbetweenimmunityandyourgutwhatleadstopoorguthealthhowtooptimizeyourdiettoimproveyourgutwatchit,here:highlightsfrompart1ofourguthealthdiscussionwithdahliaandjames howdoyouknowifyourgutisunhealthy? youshouldalwaysbethinkingaboutyourguthealthbecauseweknowthatyourgutcommunicatessystemicallywithallofyourorgans.ifyousay...i'mbloatedidon'tpoopeverydayihaveacneihaveahormonalimbalance.ihavebloodsugarirregularities.ihavereallyhighcholesterol.ihavehighbloodpressure.thereislikelysomethinggoingoninyourgut.isimmunitylinkedtoguthealth? innateimmunityiswhereyourmicrobesarebuildingamucosalbarrier.theyhelpreinforcethestructuresofyourphysiologyandanatomy...there'smicrobiomeinyournasalmucosa.there'soralmicrobiomewhenyou'reeatingorbreathing.anywheretheoutsideenvironmentcomesintocontactwithyourbody,youhavetheselittlemicrobialwarriorstherebuildingupthatbarrier,andbeingthedoormantoprotectyourbody.thatinnateimmunityisyourfirstlineofdefense.whatleadstopoorguthealth? ifyou'reeatingahealthyplant-baseddiet,exercising,andresting,you''redoingthatdailyworktofeedintoandloveyourgutmicrobes.theprebioticfiber,solublefiber,insolublefiber,phytonutrients,andantioxidantsallarefoodandfuelforthemicrobes.inadditiontoexercise... exercisecanincreasetheoutputofshort-chainfattyacids,whichhelprepairyourgutmicrobiome.sleepisachanceforthemtocatchup,getrestored,andgetinbetterbalance.ifyoueatlotsofplants,exerciseregularly,andsleepwellbutstilldon'tfeelright,it'stimetounderstandyourfoundation. weretherethingsthataffectedyourfoundationpriortoyoumakingthesechanges?weaskourpatientsquestionslike,howwasyourmom'sguthealthwhenshewaspregnantwithyou?weknowthatmicrobiomescancommunicate.wereyoubornvaginallyorviaac-section?wereyoubreastfed?howwasyourdietasachild?howmanyantibioticsandsteroidshaveyoutakenthroughoutyourlife?haveyouhadperiodsofyourlifewhereyouwereextremelystressed?haveyougonethroughtrauma?haveyouhadaperiod,collegeformostofus,whereyouarenoteatingthebestorbingedrinking?withthatknowledge,youcanhavepatienceandunderstandingofwhatwasyourguthealthstoryleadinguptothispoint.nowwhatcanyoudoaboutit?wecan'tbuildatimemachineandgoback,butwecanhoneinoncertainhabitsandworktorepairthefoundationofyourgut. imagineyouhavetwodifferentcitiestryingtogrowagarden.theyhaveeverything—theraisedbed,theseeds,thesoil,thewater.however,thisiswherecontextmatters,yourealize,"hey,i'minacityinalaska,notacityinsoutherncalifornia."yourgardenwillbeverydifferent.youmayhavethesamefoundationalitems,buttheclimatematters,thewaterqualitymatters,andmaybetherearesomecontaminantsinthesoil.thisiswhereyoumayneedbettercompostoryoumayneedsomeotherfertilizers.youmayneedagreenhousetocover.andtherearealltheseotherkindsofadditives,whetherwe'recomplimentingorjustaddingsomeofthesejustminortweaksyouneedbecauseyou'reinadifferentcity,thenthat'swhatweneedtodo.thefoundationforproperguthealthcouldbethere,butitrequiresyoutodigdeeperanddiscoverwhatadjustmentswillhavethebiggestimpact.howdoesaplant-baseddietimproveyourguthealth? withanydiet,youwanttolookatwhatmaybecausingissues.foodslike:refinedsugarrefinedgrainssaturatedfatsfromfoodslikecoconutoilorpalmoilalcoholcanallbeproblematictoyourguthealth.aplant-baseddiet,however,isfulloffiber,whichhelpsfightoraddressthefoodsthatmaycauseanissue.fruits,vegetables,nuts,seeds,beans,grains,legumes,herbs,andspices,bringinfiber,antioxidants,andphytonutrients.itmighttaketimetoseebenefits,butadietbuiltaroundhealthplantfoodswillhelpaddressmanyofthecoreguthealthissues.

How Gut Friendly Is Your Diet?

+Read article

Plant-Based Gut Health 101: Why Immunity, Metabolism, and Longevity Start in the Gut
plant-basedguthealth101:whyimmunity,metabolism,andlongevitystartinthegutwrittenby:dahliamarin,rdn,ldandjamesmarin,rd,enlongevity,diseaseprevention,energy,immunity…everyhealthbuzzwordcomesbacktoonething:yourgut.well,technicallythetrillionsofmicrobesprocessingthenutrientsfromthefoodsyoueat.andwhenitcomestoguthealth,theplant-baseddietisasuperstarpromoter.simplybyconsumingavarietyoffruits,vegetables,greens,nuts,seeds,beans,legumes,spices,andherbseveryday,you’repumpingyourbodywithamega-doseoffiber,macronutrientsandmicronutrientsthatplayasignificantroleinahealthyflowingandbalancedgutmicrobiome.butifguthealthisaseasyaseatingplants,whyisitsuchahottopic—evenamongstplant-basedeaters?becauseit’snotquiteaseasyas“justeatplants.”painfultohear,weknow.asplant-basedregistereddietitiannutritionistsspecializinginguthealth,wehearfromclientsdailythattheirguthealthimprovedtremendouslywithaplant-baseddiet…andyetthey’restillexperiencingsymptomslikebloating,gas,constipation,fatigue,andabdominalpains.orarguablyworse,notexperiencingthepositiveimmunesupport,brainfunction,andenergyboostthatcomefromagutfunctioningoptimally.sowhat’stheanswer?inthispost,we’llpullfrom10+yearsofexperience,helpingthousandsofpatientsidentifyandunderstandtheirguthealthproblemstosharetheinsandoutsofahealthygut,plusthesimplestepsyoucantaketodaytooptimizeyours.thebestpart?ifyou’realreadyeatingaplant-baseddiet,you’releapsandboundsaheadofmostpeople.considerthehardpartdone.nowcomesthefunpart—simplehabitstohelpyourgutthrive! whyguthealthissocritical(evenforplant-basedeaters) 70%ofyourimmunesystemislocatedwithinyourgut.immunecellsinteractwiththebacteriainyourgut,andthemorebalancedthatbacteriais,thehappierthoseimmunecellsbecome.butthat’snotall—yourgutalsoproducesnearlyallofyourserotonin(thehappinesshormone),expendsupto20%ofyourenergythroughdigestion,regulatesyourmetabolism,andsomuchmore.thismakesimprovingguthealththesinglemostimportantthingwecandoforbothourshort-andlong-termhealth.butwhatdoes“guthealth”reallymean?whenwetalkaboutahealthygut,wearereferringtothehealthofthemicrobiomeandviromethatresidesinthedigestivetract.thesearelikemini-ecosystemsofvastlifethatresideinsideofus,withthemicrobiotabeingmadeupofcountlessmicrobesincludingbacteria,yeast,fungi,protozoa,andarchaeaplayinganimportantroleindigestionandnutrientsynthesis.justasadiverseecosystemofanimals,insects,andplantssupportthecircleoflifeinthenaturalworld,eachmicrobeplaysitspartinyourgutecosystem—supportingeachotherinoneformoranotherandcommunicatingwithsystemicorgansincludingyourheart,liver,pancreas,skin,reproductiveorgans,brain,andmore.thegutmicrobiomeisresponsibleforimportantfunctionsinourgutsuchasthesynthesisofvitamins,essentialaminoacids,andgut-repairingshort-chainfattyacids.butlet’stakealookattwoofthemostimportantfunctionsofthegut,andhowtheywork: 1.immunesupportabout70%ofourimmunecellsrootinourgut.aninfectionorimbalanceinthegutcancommunicatestresssystemically,andvice-versa.yourgoodgutbacteriaisalsopartiallyresponsibleforhelpingprepareyourimmunesystemtofightoffviralinvaders,somaintainingthebalanceofyourgutmicrobiotaisimportanttoyourimmunesystemfunction.2.metabolism yourgutmicrobesareresponsibleforthesynthesisofdifferentvitaminssuchasvitaminsb5,b12,andvitamink,aswellasmakingshort-chainfattyacids(scfas)outofunabsorbedsugarsinyourdigestivetract.thesescfasarethenusedasfuelbyyourdigestivetractmucosa,keepingithealthyandfunctioningasitshould.vitaminkhelpsourbodiesclotourbloodaswellasmanagingtheamountsofgoodandbadcholesterolwehaveinourbodies.deficiencyinb5andb12vitaminshasactuallybeenlinkedtogidiscomfort,makingitthatmuchmoreimportanttokeepourmicrobiomesdiverseandflourishing.isyourguthealthy?herearethewarningsigns haveyoueverheardof“gutbugs?”that’showweliketorefertogutmicrobes,andtherearetrillionsofthemlivingwithinyourgastrointestinaltract.thebalanceofthesegutbugsisessentialtoahealthygut,andsoisthepaceoftheirflowthroughyourdigestivetract.whengutbugsareoutofbalance,itcantriggerwarningsignslike:regularbloatingexcessivegasconstipationnauseabrainfogdiarrheaacidrefluxornon-gutsymptomslike:lowenergyandpersistentfatiguetroublesleepingorinsomniaskinirritations,likeeczemaordermatitisfrequentmoodchangesanxietystrongfoodcravingsforfoods,includingsugar,andrefinedcarbohydratesjointpainpost-nasaldriporconstantthroatclearingthinkofafloodhappeninginanaturalecosystem;someanimalsaredrivenoutwhileothersflourish.animbalanceisrarelygoodfortheecosystemandcanleadtothedominanceofaplantoranimalthatcausesfurtherharmtoeverythingelse.inyourbody,theseuncomfortablesymptomscanbecausedbydysbiosis(theimbalanceofbacterialivinginthegut)ordysmotility(suboptimalgutflow)andshouldbegivenspecialattention.andwhendysbiosisordysmotilityarepresent,eventhepurestwholefoodplant-basedeatersmayrunintotheseuncomfortablesymptoms.fortunately,mostofthecommonsymptomscanberesolvedthroughminorlifestyleandnutritiontweaks.weseethisoverandoveragaininthepatientsweworkwith…takedanny,forexample(arealpatientwithareallymade-upname).dannyisaprofessionalplant-basedchefwhohadbeenfollowingawholefoodplant-baseddietfor10yearspriortocomingtous.shewasfedupwithhersymptomsofdailyuncomfortablegas,bloating,andconstipation,whichinterferedwithherevenwantingtotastethedeliciousplant-basedrecipesshewascreating. orthere’sgina,a3-yearplant-basedeaterwhowantedtoreducethebloatingsheexperiencedaftermealsassheworksasayogainstructor.oranna,aplant-basedchiropractorwhohadtrainedinsomeoftheworld’smostrenownedplant-basedfacilities,learningthespecificsofoptimalplant-basedeating,yetstillcouldn’tgettothebottomofwhatwasdrivingherdailystomachdiscomfort.ineachofthesesituations,afewminorlifestyletweaksliketheonesoutlinedbelowleadallthreeofthesepatientstoexperienceanover80%reductionintheirsymptomsinarelativelyshortperiodoftime.8simplewaystoimproveyourguthealth 1.introducemore‘goodgut’foods. inourhouse,foodsfallintooneoftwocategories:goodgutfoods,whicharetypicallyhighinfiberandmicronutrientsandcontributepositivelytothegut.other‘sometimes’foodsthatdon’tcontributetoguthealthtoowell,thatweconsumeinmoderation.thesimplestthingyoucandotosupportguthealthistointroducemoregoodgutfoodsintoyourdietandreducetheonesthataren’t.seasonalfoodsandnutrient-denseproduceareagreatwaytofeedyourhealthygutbugs.herearesomeofthefoodsthattopour“goodgutfood”list:veggiesandgreens:arugulabokchoybroccolifloretscarrotsjapanesesweetpotatookraradishessproutszucchiniwintersquashfruits:bananas(especiallygreenerbananas,whicharehigherinresistantstarch,whichissogoodforyourgut!)blackberriesblueberriesclementinekiwis(greenorgolden)papayapomegranatepricklypearnutsandseeds:almondsbarunutsbrazilnutschiaseedsflaxseedshempseedspumpkinseedswalnutsbeansandlegumes:lentilschickpeasedamame(soybeans)mungbeansadzukibeanstofutempeh(fermentedsoybeans)wholegrainsbuckwheatmilletoatsquinoaamaranthfoniosproutedwheatother:cilantrogingermiso(fermentedsoyorchickpeapaste)parsleypeppermintfermentedfoodslikekimchiorsauerkrauttahini(sesameseedpaste)vinegars 2.eat30+plantsperweek(atleast!). theamericangutprojectfoundthatindividualswhoconsumed30ormoredifferentplantfoodseachweekhadasignificantlymorediversegutmicrobiomecomparedwiththosewhoate10orfewerperweek.thishasbeencorrelatedwithincreasingyourmicrobialproductionofshortchainfattyacids(scfas)anddecreasingantibioticresistantmicrobes(superbugs).combined,thesemeanhealthiergutstructureandapossibledecreaseofintestinalinflammation.inotherwords,eatingaplant-baseddietisoneofthebestfirststepsyoucantaketoimproveyourguthealth,butvarietyisjustasimportant.onthesurface,30maysoundoverwhelming,solet’sbreakdownanexampledayandseehowmanywecanget:breakfast:carrotcakeovernightoatmealwithfruitandnuts(soakingoatsovernightincreasestheresistantstarchandactivatessolublefiber)oats(welikeoatgroatsorsteel-cutoats)flaxseedschiaseedscomplementproteinpowderwalnutsshreddedcarrotsraisinsdatescinnamonsnack:fruit&proteinappleorpearalmondbuttercelerylunch:grainbowl quinoalentilssproutsredbellpeppercucumbertomatocarrotsyummyplant-baseddressingofchoicesnack:smoothiebananaorangespinachzucchinisoymilkhempseedsdinner:veggieandbeanpastaandmixedgreenssaladchickpeapastabroccolioniongarlicbasilkaleromainelettuceredleaflettucebeetssnappeassunflowerseedsvinegarherbs&spicesthat’s39differentplantsinasingleday.whenyouaccountforeachplant,herbs,andspices,suddenly30plantsbeforetheendoftheweekdoesn’tseemaschallenging!still,eating30+differentplantsperweekrequiresyoutobeintentionalaboutthevarietyyouincorporatethroughoutyourmeals,andreally,30shouldbetheminimum.3.eatslowly. properdigestionstartsinyourmouth.itis,afterall,thefirstportionofthedigestivetract,andagreatstartcanhelpfacilitateagreatending!chewingyourfoodthoroughlycanbeessentialtoproperdigestion.quicklyscarfingdownfoodusuallyleadsyoutoalsoinhalequiteabitofairbetweenbites,whichcanleadtobloatinganddiscomfortafterward. chewingfoodsuntilthebiteissmoothandnolongerchunkycanhelptherestofthedownstreamdigestionandabsorptionthatwillhappeninthestomach,smallintestine,andlargeintestine,helpingyouabsorbmorenutrientsandfeelyourbestafterthemeal.ifyou’reseeinglargepiecesofundigestedfoodinyourstool,thatcanbeasignofdigestivedistressandimproperchewing.whenweeatcarbohydrates,oursalivacontainsdigestiveenzymesthathelpusbetterbreakdownanddigestthem.thiscanevenmatterwhenconsumingcarbsthatdon’tneedchewing,likesmoothies.chewingthemabitinyourmouthcanhelpslowdownhowquicklyyoufinishthemandcanhelpreducebloatyoumayexperiencewhendrinkingthem.suggestiveresearchshowsthatthebetterapersonchewsthemorelikelytheyaretostimulateguthormonesthathelpregulatesatiety. 4.consciouslychooseyourcookwareandcleaningproducts. whatyoucookandstoreyourfoodinwillultimatelymakeitswayintoyourgut.wesuggestswappingoutplastic,aluminum,andotherknownendocrinedisruptorswithmaterialsincludingglass,ceramic,stainlesssteel,andcastiron.onestudyfoundthatendocrinedisruptorshaveinteractionswithfoodandthegutmicrobiota.theproductsandbyproductsreleasedfollowingthemicrobialmetabolismofendocrinedisruptorscanbetakenupbythehost,changingthecompositionofmicrobiota. 5.avoidantibiotics,unlessnecessary. wearesofortunatetobealiveinatimewhenmedicineisprettyaccessibletomostpeopleindevelopednations.thiseasyaccessibilityhascausedexcessuseinbothhumansandanimalsraisedforconsumptioninthepastfewdecades,whichleadstoantibioticresistanceinhumansandcontaminationofwatersourcesfromanimalrun-off.inyourgut,antibioticresistancecreatesbadgutbugsthatareresistanttoantibiotics(superbugs)thatcandriveupinflammationiftheyover-populatethebody.antibioticscanbetrulylifesavingiftakenwhennecessary,buttheycanalsooff-setthedelicatebalanceinthegut.onestudyshowedthatasinglecourseofantibioticscanhaveeffectslastinguptotwoyearsonthebalanceinthegutmicrobiome.speakwithyourcareteamtotakeantibioticswhenit'swarranted,trytoavoidthemiflifestyleandotherpreventivemeasurescanbeusedinstead. 6.exerciseconsistently. theusdahealthypeople2022guidelinesrecommendatleast150minutesofmoderatetointenseactivityperweek.werecommendasmuchaspossible!anhourofconsciousmovementandexercisemakesitswayintoeachdayofourlivesandhelpssupportourgutmovementakagutmotility.studiesshowthatmoderateexercisecandecreaseconstipationandbloating. andno,couchsurfingdoesn’tcount!sorry. 7.reducestress(asbestaspossible). stressofanykind–physical,mental&emotional,orchemical–cantakeatollonyourgoodgutbugs.addressingstressorsandfindingoutletsforthemcanbekeytohelpingyourgutfeelitsabsolutebest.studiesshowthat40-60%ofthosediagnosedwithirritablebowelsyndrome(ibs)havealsobeendiagnosedwithanxiety.whatstressesyourmindorbodycandefinitelystressyourgut.remember,wearemoremicrobialdnathanhumandna,andthey’resensitivetoo! 8.incorporateevidence-basednutrients. evenwithadiverseplant-centereddiet,increasingtheintakeofcertainvitaminsandmineralscanhavearapidanddramaticimpactonimprovingyourgut.rememberdanny,theplant-basedchefweintroducedearlier? afteridentifyingafewdeficienciesinherbloodwork,wehadhersupplementwithadditional:pre-activatedbvitamins,includingb1,b5,andb6,whichareallessentialformotilityandoptimalbrainfunction.suggestiveresearchshowsthatb-vitaminsarerequiredfordifferentimmuneresponsesrelatedtoguthealth.molybdenumtohelpmetabolize/break-downsulfur,toreducetheamountofhydrogensulfidegasproduced.thistypeofgascannotonlycausemalodorousgasstrongenoughtocleararoom,itcansignificantlyslowdownmotility,causinguncomfortablebloat.gingertohelpsupportmotilityandahealthygutrhythm.pepperminttoalsosupportmotility.welikerecommendingdrinkingstrongpeppermintteabetweenmealstohelpgetthefoodmovingthroughthedigestivetract.thathelpedrestorehergutmotilityandgutbalancewhichinreturnreducedherdiscomfortandbloating.inadditiontothosewerecommendedtodanny,nutrientadditionsthatcantypicallyleadtoimprovedguthealthare:horsechestnut,apotentantioxidanttohelpbalancethegutmicrobiomeandsupportthegut-immuneconnection.alowfodmap,lessfermentableprebioticfibertofeedtheanti-inflammatorygutflora,whichcanhelpbringdownbloodsugar,cholesterol,appetite,andmore.apost-biotic-apotentend-productoffermentationofprebioticfibersbyprobioticsandothermicrobes.licoriceroottohelpsootheanyirritationsfeltinthegutandsupporttheintegrityoftheliningoftheguttopotentiallydecreaseinflammationinandaroundthegut. shouldyoutakeaprobiotic? probioticswerealltherageforawhile,withcompaniesandinfluencerstellingyouthattheywouldsolveeverybelch,bloat,andbumpinyourbody.thatstartedinpartbecauseforalongtime,healthcarepractitionersweretoldtorecommendprobioticsaftereachcourseofantibioticstakentorestoregoodbacteriawhichmayhavebeenwipedout.butathorough2018studyoutofisrealdiscoveredprobioticsupportmaynotbeinourbestinterestafterall.thestudyshowedthosetakingnon-specificprobioticsafteracourseofantibioticstookthelongesttorecovertheiroriginalgutmicrobiomeandthegoodbugsthatliveinit.sowhatdowerecommendinstead?,tobeclear,probioticsaren’talwaysbadforyou.infact,a2017studypublishedintheeuropeanreviewformedicalandpharmacologicalscienceseshasfoundthataspecificstrainofprobiotic,lactobacillusreuteri,canreducemethanegasinthedigestivetractbyasmuchas30%.thiscanhelpreducebloatandgasasmethanegasisknowntoslowdownthedigestivetract.therefore,l.reuteriresultsinreducingthegutmethanogenicflora,thenincreasingbowelmovementshelpingwithconstipation.whatwedon’trecommendisunnecessarilytakingexpensiveprobioticsthatyoulikelydon’tneedifyouconsumeadiversediet.researchsuggeststhatitisidealtolookattheoriginofthemicrobes,speciesandstrains,testing,andpotencywhenchoosingaprobioticsupplement.notallprobioticswillhavewhatthelabelsaysithas,notallstrainswillhaveabenefit,notallsupplementswillmakeitpastyourstomachacidandbile,andtherecanbesomenegativesideeffectsalongtheway. don’tflushyourguthealthdownthetoilet guthealthisalltheragerightnownotbecauseit’sdifficulttoachieve—aswementionedbefore,ifyoueataplant-baseddiet,you’’soneveryone’smindbecauseit’ssoimportant,withcountlessnewstudiesdrivingthatpointhomeandhopefully,ontoyourplate! soquitthinkingaboutyourgutasjustaplacetoprocessfoodandproducewaste,andinsteadtreatitlikethedelicateecosystemthatitis…onethatifkeptbalanced,willleadyoutowardsastrongerimmunesystem,bettermetabolism,lowermortalityrate,improvedsleepandenergy,loweranxiety,andday-to-dayabdominalcomfort.wehopewe’vegivenyouencouragementtocontinueyourjourneytowardoptimizingyourguthealth,evenbeyondthewaysyourplant-basedlifestylehas! references:u.s.departmentofagricultureandu.s.departmentofhealthandhumanservices.dietaryguidelinesforamericans,,r.,quigley,e.,abbas,z.,eliakim,a.,emmanuel,a.,goh,k.l.,guarner,f.,katelaris,p.,smout,a.,umar,m.,whorwell,p.,johanson,j.,saenz,r.,besançon,l.,ndjeuda,e.,horn,j.,hungin,p.,jones,r.,krabshuis,j.,&lemair,a.(2014).copingwithcommongastrointestinalsymptomsinthecommunity.journalofclinicalgastroenterology,48(7),567–578.,c.,löfmark,s.,edlund,c.etal.long-termecologicalimpactsofantibioticadministrationonthehumanintestinalmicrobiota.ismej1,56–66(2007). levy,r.l.,olden,k.w.,naliboff,b.d.,bradley,l.a.,francisconi,c.,drossman,d.a.,&creed,f.(2006).psychosocialaspectsofthefunctionalgastrointestinaldisorders.gastroenterology,130(5),1447–1458. miquel-kergoat,sophie;azais-braesco,veronique;burton-freeman,britt;hetherington,marionm.(2015).effectsofchewingonappetite,foodintakeandguthormones:asystematicreviewandmeta-analysis.physiology&behavior,151(),88–96.doi:10.1016/j.physbeh.2015.07.017nationalinstituteofenvironmentalhealthsciences.(n.d.).endocrinedisruptors.retrievedmarch3,2022,from peyrotdesgachons,c.,&breslin,p.a.s.(2016).salivaryamylase:digestionandmetabolicsyndrome.currentdiabetesreports,16(10). quigleye.m.(2013).gutbacteriainhealthanddisease.gastroenterology&hepatology,9(9),560–,y.,jiang,y.,deng,y.,yi,c.,wang,y.,ding,m.,…wong,a.(2020).probioticsupplements:hopeorhype?frontiersinmicrobiology,11.doi:10.3389/fmicb.2020.00160zmora,n.,zilberman-schapira,g.,suez,j.,mor,u.,dori-bachash,m.,bashiardes,s.,kotler,e.,zur,m.,regev-lehavi,d.,brik,r.b.z.,federici,s.,cohen,y.,linevsky,r.,rothschild,d.,moor,a.e.,ben-moshe,s.,harmelin,a.,itzkovitz,s.,maharshak,n.,...elinav,e.(2018).personalizedgutmucosalcolonizationresistancetoempiricprobioticsisassociatedwithuniquehostandmicrobiomefeatures.cell,174(6),1388–1405.e21.  

Plant-Based Gut Health 101: Why Immunity, Metabolism, and Longevity Start in the Gut

+Read article

Vitamin B12 and the Plant-Based Diet: Everything You need to Know
vitaminb12andtheplant-baseddiet:dr.joelkahnonsupplementingforlong-termhealth,energy,&nervoussystemsupportby:dr.joelkahn,mdwe'veallheardaboutthevalueofsupplementingwithb12—especiallyforplant-basedeaters.vitaminb12islinkedtoeverythingfrombrainandnervoussystemhealthtoyourenergy,dna,andredbloodcells,andcountlessstudiesshowthatvegetariansandvegansrunahigherriskofb12deficiencies.*buthowmuchdoyouneed,andwhatapproachshouldyoutaketoensureyougetenough?tohelpyoufindthestrategythatworksforyourhealth,irecordedashortvideosharingtheb12supplementationmethoditakewithpatientsatthekahnlongevitycenter.watchit,here:videonotes: whyisvitaminb12important? butdidyouknowthatyoucan'tmakeanyusableformofvitaminb12?and,ifyoucan'tmakeanyusableform,you'resetuptobedeficientinb12.mostb12vitaminsaremadebybacteriathatanimalseatandgetincorporatedintheirflesh.plant-basedeaters,however,typicallyneedsupplementation.why?b12impactsyourbrain,yournerves,thereactionofredbloodcells,andevenyourgeneticcode—yourdna.* shouldyousupplementwithmultipleformsofb12? therearedifferentkindsofvitaminb12,andthebestapproachtosuccessfulsupplementationmaybetomixthevariouskinds.onereasonisthateachformhasalittledifferentpropertyorfunctioninthebody.therearetwonaturalforms,calledadenosylcobalaminandmethylcobalamin.adenosylcobalaminworksparticularlyinthemitochondria,wherewemakeenergy.*methylcobalaminmaybethemostnaturalandimportantformofb12.itkeepsourbloodhomocysteineatanoptimallevel.*anotherformiscalledhydroxocobalamin,whichisveryeasilyabsorbed,andlinkedtoyourbrain,nerve,mitochondria,heart,bloodcells,anddnarepair.*irecommendpullingfromallthreeoftheseformssothatyouhavearegularsourceofavarietyofb12sforoptimalhealthandbodyfunction.*itmayalsoincreaseyourabsorptionrateifyourbodyhastroubleabsorbingoneformbutnotanother.* canyoutaketoomuch? aswithsomanythingsinlife,’smorethanyouneed,butshouldincreaseyourlikelihoodofproperabsorption.andbecauseit’swater-soluble,thereislittleriskofoverloadingtothepointoftoxicity.

Vitamin B12 and the Plant-Based Diet: Everything You need to Know

+Read article

Vegan Mint Chocolate Chip Ice Cream Recipe

Vegan Mint Chocolate Chip Ice Cream Recipe

+Read article

18 Recipes for the Ultimate Plant-Based 4th of July Cookout
18recipesfortheultimateplant-based4thofjulycookoutby:complementwith4thofjulycelebrationsunderway,cookoutseasonhasofficiallybegun.forplant-focusedeaters,cookoutsaren'talwaystheeasiesttonavigate,especiallyifyou'reattendingoneasaguest.theriseofplantmeatslikebeyondorimpossiblehavemadeitaloteasier—offeringaconvenientandapproachableoptionforbothhostsandguests.butplantmeatsaren'ttheonlythingworththrowingonthegrillorbringingtoapartythissummer.cookoutfoodisallaboutkeepingthingssimple,fresh,andeasytoshare,andthereareendlesscrowd-pleasing,plant-baseddishesthatfitthatdescription. ifyou'reheadedtoacookoutthisholidayorsummer,here'sadeliciousmenuofwholefoodplant-basedoptionsyoucanprepaheadorthrowonthegrillatthelastminute. summertimesaladsandsidedishes 1.longweekendgrilledsalad,whichhighlightsmanyoftheseason’sfreshestveggies.2.keepitrefreshingwiththeredchilecornsaladwithlimas&cherrytomatoessalad.3.mexicanstylegrilledcorn,asummertimepartyfavorite.4.what’sacookoutwithoutbakedbeans?stepawayfromthecannedoptionsandtryoutthismaplebakedbeansrecipe.5.alwaysapartyfavorite,mattfrazier’sbuffalohummus. plant-baseddipsandsaucestospiceupyourcookout 6.guacamole.youjustcan’tgowrongwithfreshguacamole.7.grill-smokedeggplantdipforasmokytreat.8.skipboringtraditionalsalsaandmixitupwiththisradradishandnectarinesalsa.9.whenitcomestobbqsauce,simpleisoftenbetter.itdoesn’tgetmuchsimplerthandel’sbasicbarbecuesauce.10.oneofmyfavoritewaystodressupaburgerorveggiedog:cashewcreamsauce.kickitupanotchbyaddingchipotleseasoningtothestandardrecipe,orlightenuptheflavorwithcilantrolimegarliccashewsauce. grillableentreeseveryonewilllove 11.surpriseyourguestswithcreamyredpepperscallionspreadgrilledflatbreads.12.hawaiianbbqtacosfromripesselstyn’smybeefwithmeataretheperfectsummertimemarriagebetweensweetpineappleandsavorybbqsauce.werecommendgrillingthetortillasforaspecialtouch.13.carrotdogs?carrotdogs.soundscrazy,butthisalternativetotheprocessedveggiedogisaguaranteedhit(oratleastaconversationstarter).throwthemonthegrillforextraflavor.14.keepthepreparationsquickandsimplewiththeseperfectgrilledportobellos.15.ifyou'rewhippingupaveggieburger,youcan'tgowrongusingthisveggieburgerblueprintfromnomeatathlete. beautifulsummernightdesserts 16.peanutbutterblissballsareperfectnomatterthetimeofyear.17.coolthingsoffwithhomemaderaspberrysorbet.18.spicygrilledwatermelon…simple,sweet,andtheperfectsummertimetreat. bonus:hydratecocktailsandmocktails! beatthesummerheatwitharefreshingandrehydratingdrink.herearethreefundrinkrecipesguaranteedtomakeaspash.1.hydratespritz(withagreenoption!).2.pinkmimosaforyourafternooncookouts.3.strawberrygin&tonic...atwistontheclassicsummercocktail. 

18 Recipes for the Ultimate Plant-Based 4th of July Cookout

+Read article

Complement Hydrate Electrolyte Spritz Recipe
hydratespritzrecipeby:complementwhilethestandardhydrateinstructionscallforamixofpowderwithplainwater,there'snoreasonyoucan'thavealittlefunwithit!therapidhydrationbenefitsofhydrateworkjustaswellwithsparklingwater,andthecombocreatesabeautifulmocktailperfectforasummertimetreat.letthishydratespritzrecipeactasinspirationforyoutomakeityourown!checkouttherecipe,here:ingredientssparklingwater1servingofhydrate 1slicedstrawberry3slicesofcucumber1lemonwedgedirectionscombinesparklingwaterandhydrate.stirinstrawberriesandcucumber.addlemonslicetoedgeofglass.optionalgreentwist!addaservingofdailygreensforaboostofnutritiousgreens.(andyes,thisactuallytastesgreat!)hydrateelectrolytemixidealfordailyhydrationneeds,morningrevitalization,andathletes,hydrate'sflavorfulblendofelectrolytesareformulatedtohelpspeedupabsorption,improveyourperformance,andinvigorateyourbody.*shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Complement Hydrate Electrolyte Spritz Recipe

+Read article

Complement Hydrate Electrolyte Strawberry Gin & Tonic Recipe
strawberrygin&tonicrecipeby:complementtheremaybenoeasiercocktailtoputyourowntwistonthanaginandtonic.gininfusesbeautifullywithfruitsandcitrus,andtonicactsasablankslatetoenhancewhateverflavorsyoubringtotheglass.thishydratestrawberrygin&tonicrecipeisbothrefreshingandrehydrating,poppingwithflavorandelectrolytes.checkouttherecipe,here:ingredients1shotginofchoice1tsphydratetonicwaterlemonicedirectionscombinegin,hydrate,andtonic,andiceinatallglass.addlemonslicetoedgeofglass.hydrateelectrolytemixidealfordailyhydrationneeds,morningrevitalization,andathletes,hydrate'sflavorfulblendofelectrolytesareformulatedtohelpspeedupabsorption,improveyourperformance,andinvigorateyourbody.*shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Complement Hydrate Electrolyte Strawberry Gin & Tonic Recipe

+Read article

Complement Hydrate Electrolyte Strawberry Mimosa Recipe
mintchocolatechipnicecreamby:complementwhetheryou'rehostingbrunchwithfriends,enjoyingadayatthelake,orattendinganafternooncookout,mimosasarealwaysahit.thispinkmimosarecipe,featuringcomplement'shydrateelectrolytemix,addsanewtwist.thecitrusandstrawberriespairperfectlywithabrightsparklingwine,andtheaddedelectrolyteskeepyoufeelingyourbestthroughouttheday(ornight)!checkouttherecipe,here:ingredients1tsphydrateproseccoorchampagne1strawberrydirectionsgentlymixhydrateintothesparklingwine.garnishwithstrawberries.hydrateelectrolytemixidealfordailyhydrationneeds,morningrevitalization,andathletes,hydrate'sflavorfulblendofelectrolytesareformulatedtohelpspeedupabsorption,improveyourperformance,andinvigorateyourbody.*shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Complement Hydrate Electrolyte Strawberry Mimosa Recipe

+Read article

Hydration FAQ for Optimal Performance and Long-Term Health
hydrationfaqwithdr.estello,md:howtohydrateforoptimalperformanceandlongevityby:matttullman,co-founderhydratingsoundssimpleenough...drinkwater,often.butonceyoutakeacloserlook,stayingproperlyhydratedforworkouts,generalhealth,longevity,andfeelingyourbestisn'tasstraightforward....howmuchshouldidrinkwhenrunning?...doineedelectrolytes?...doescoffeeandbeercounttowardsmyfluidintake? withhydrationplayingacrucialroleineverythingfromregulatingbodytemperaturetolubricatingjointsanddeliveringnutrientsandenergytocells,alittleattentioncangoalongway.tohelpusunderstandhydrationbestpractices,iaskeddr.estellonaphill,md,aninternalmedicineresidentdoctorandplant-basedultra-marathonathletetoweighin.checkouthisadvice,here:dr.estellonaphill,md,hydrationfaqnotes 00:25-howmuchwatershouldidrinkeveryday? itdepends.howmuchwedrinkshouldbeindividualizedanditdependsonthingslikeyouractivitylevel,howhydratedyouarethedaybefore,andthehumidityandtemperatureoutside.agoodplacetostartistryingtodrinkhalfyourbody'sweightinounces.soforexample,i'm200pounds,'salsowhatyoueat.didyouknowthatplant-basedfoodshave80to90%watercontentwhileotherfoodssuchasprocessedorfriedfoodshavealotofthewatercookedoutofthem?sowhenyou'retryingtolookathowmuchwateryou'regettinginaday,it'swhatyoudrinkbutalsowhatyoueat. 01:55-whathappensifidon'tdrinkenoughwater? wateristhesecondmostimportantthingthatyourbodyneeds,secondonlytooxygen.whathappenswhenyoudon'tdrinkenoughwater?yougetdehydrated.someofthesignsofdehydrationaredecreasedurineoutput,increasedthirst,fatigue,irritability,andwhenyou'rereallydehydrated,itcanleadtothingssuchasareallylowbloodpressureanditmightevenlandyouinthehospitalortheicu.clinicaldehydrationaside,there'salsoalotofevidencetosupportthatevenalittlebitofdehydrationcanaffectathleticperformance.losing1to2%ofbodyweightinwaterhasbeenshowntohavea10%reductioninexercisecapacity.inadditiontothat,italsohasbeenshowntoincreasetheperceptualstrainofexercise,whichmeansthatevenifyou'reabletodothesameamount,it'sgonnafeelawholelotharder 03:15-howmuchshouldwedrinkwhenwe'reworkingout? didyouknowyoucanloseuptoonetofivepoundsofsweatperhourwhileworkingout?'salsogotelectrolyteslikesodium,chloride,potassium,magnesium,andcalcium.soit'sreallyimportantthatwhenwe'rerehydratingduring,afterandbeforeexercise,we'reusingasolutionthat'snotjustwaterbutthat'salsogottheelectrolytesthatweneed.howmuchwateryoushoulddrinkduringaworkoutdependsonyourbodyweight,yourexerciseintensity,howlongyou'reexercising,andtheheatandhumiditythat'sintheareaaroundyou.thereareafewdifferentformulasyoucanusetocalculatehowmuchexactlytodrinkwhenworkingout.andoneoftheonesthatiliketouseistotakeyourbodyweightinpoundsanddivideitby30.andthen,you'regonnadrinkthatamountinouncesevery15minutes.thebestwaytoestimatehowmuchyou'vesweatedoutduringaworkoutissimplytoweighyourselfbeforeandafter.youshouldtryanddrinktheamountthatyoulostandthenalittlebitextratomakeupforstuffthatyou'regonnapeeout.soforexample,ifilostakilogramofweightwhileworkingout,'simportanttobeextrahydratedafteryourworkoutsothatyoucanbefueleduptogointoyournextone. 04:48-doescoffee,soda,orbeercounttowardshydration? youmayhavenoticedthatwhenyoudrinkcoffeeorbeer,youhavetopeealot.that'sbecauseit'sadiuretic.adiureticissomethingthatmakesusgopeemoreoftenandmorefrequently.thewaythatcaffeineandalcoholmakeuspeemoreisitinhibitsahormonecalledantidiuretichormone.andthatcausesustopeeoutmorewaterratherthanreabsorbingandkeepingitinourbodies.thatsaid,theamountthatyoupeeoutisn''renotgonnapeeoutsomuchwaterthatyou'regonnabecomedehydrated.butbecauseyou'repeeingmoreandyou'regettingonlyalittlebitofthefluidyou'redrinking,it'snotthebestchoiceforapre-hydration.

Hydration FAQ for Optimal Performance and Long-Term Health

+Read article

Why Omega-3s are Important For Your Health
dr.joelkahn,mdonthewhyomega-3smatter(andhowtogetthem)by:matttullman,co-founderthenumberoneabnormalbloodtestdr.kahnseesacrosshisclinicisn'tvitamindorb12.itisn'tproteinoriron,'somega-3s.accordingtodr.kahn,peoplejustaren',heart,andimmunehealth.andthey'reessentialforproperbraindevelopment,especiallyinkids.*sowhyisnoonetalkingaboutomegas?tohelpusbetterunderstandtheimportanceofomega-3fattyacids,isatdownwithdr.joelkahn,mdtopickhisbrainontheroleomegasplayinourhealthandhowbesttogetthemonaplant-baseddiet.(actually,hestoodup,usinghistreadmilldesk...)watchit,here:dr.joelkahn,mdinterviewnotes 04:46-whydoomega-3smatter?wecangothroughadozen-plussystemsinthebodythathavetohaveomega-3fattyacidsforoptimalperformance,andyoucan'tmakeany.that'swhatwouldbeinmy"jackandjill"book.jackandjillcan'tmakeomega-3s.theycanmakevitamindwithsomesunshine.wecangetsomeb12throughvarioussources,althoughveryoftenthat'sapointtosupplement.butforgetaboutitwhenitcomestoomega-3fattyacids.ifyou'vefailedtoplan,youplantofail.butit'snobody'sfault.they'rejustnothearingthismessage.i'vebeenaddingabloodtestcalledomega-3index,abloodtestthatmeasuresinyourbloodquiteaccuratelythelevelofomega-3.itisthenumberone,'salsooneoftheeasiestonestocorrect,alittlepatienteducationandlittlerepeattesting.buthasprofoundimplicationsforcurrentandfuturehealth.08:43-whatabouteatingfishforomega-3s?smashfish(sardine,mackerel,anchovy,herring,andsalmon),areprettyhighinomega-3fattyacidsbecausetheirhabitistoeatalotofalgae,whichcontainsdhaandepa.noneofthosefishmaketheirownomega-3fattyacids.they'rejustgoodatconcentratingoraccumulatingthemintheirflesh.andwhenweeattheirflesh,yougeteverythingintheirflesh.mightbeomega-3fattyacids,butyou'recertainlygettingadecentloadofsaturatedfat.andyoumaywellbecrunchingonsomedeliciousmercury,andpcbs,andddts,becausethefatoffishdoesliketoaccumulatebioenvironmentaltoxins.sothat'swhywe'resoexcitedaboutalgae.goingstraighttothesource.14:28-howmuchshouldyoutake?foralongtime,theamericanheartassociationwouldsayforaheartpatient,a1,000mgcapsuleadaywouldbeareasonablesupportivehealthdecisiontomake.whatikindastriveforwithmypatientsisusuallyabout500milligramsadaycombinedepa,dha.i'llgomuchhigherifi'mtreatingadisease.generalhealthsupportversustreatingadiseaseisquiteadifferentkindofapproach.21:04-doestheratioof3s,6s,and9smatter?i'makeepitsimple,stupid,'renotgonnafindmecalculatingmymacronutrientsandalleveryday.youcanlivealong,healthylifewithagreatbrain,andagreatheart,andgreatimmunehealthwithoutanyomega-9.andsameistrueofomega-6.yourbodywillhandleallthat.theonlyoneyoushouldfocusonwithanycareandconcernisomega-3fattyacids.that'swhythey'recalledessential.alotofpeoplewilltalkaboutomega-6astheawfulinflammatoryfattyacid.thecardiologyliteraturedoesn'tcompletelyagreewiththat.therearehealthyomega-6sandunhealthy,soifranklyjustditchthatbecauseit'snotaneasyevaluationtomake,andyoureallydon'thavetosay,igottaeatomega-9foods.nope.youjustneedtoeatomega-3foodsortakesome.30:41-joel'sfinalthoughti'dliketoleaveyoualastlittletidbitorpearl.imean,it'sliterallyeveryweekthere'snewscienceaboutplant-baseddiets,andnoteverybodyresponds.itellmypatientsthat,"plant-baseddietsdonotmakeyou100%bulletproof.theyjustmakeyoumuchmoreresilient."anditdoesn't...youdon'tskipyourcolonoscopyandyourmammogram'causeyoueatasaladeveryday,butitmakesyoumuchmoreresistanttohavingthosediseases.buteveryday,wecomeupwithmoreinformation,whetherit'stheenvironment,it'sobviouslyalwaysaboutanimalrights,butourhumanhealthisoptimalinadietoffruits,vegetables,wholegrains,andlegumes.

Why Omega-3s are Important For Your Health

+Read article

7 Superfood Greens You Should be Eating (But Probably Aren't)
MIN READ,greensarethemostnutrient-richfoodsyoucaneat,loadedwithantioxidants,vitamins,minerals,andsomuchmore.buttherearehundredsofediblegreens,andthey'renotallcreatedequally.whichpackthebiggestpunch,andwhichgreensshouldyoufocusonforthemostwell-roundedbenefits?inthispost,webreakdown7ofthebestsuperfoodgreenstoconsumeregularly—someofwhichmaybeonyourregularrotationalready,butothersalmostcertainlyarenot. allgreensaren'tcreatedequally. healthprofessionalsandnutritionistslovetotoutthebenefitsof"leafygreens."butjustlikeanyothercategoryoffood,whenyoucomparethenutrientprofilesofdifferentfoods,somearebetterthanothers.forexample,acupoficeberglettucecontainsabout10%ofyourrecommendeddailyvalueofvitaminsaandk,and1%ofmagnesium.acupofrawspinach,ontheotherhand,provides93%ofyourvitamina,120%ofvitamink,and6%ofyourmagnesium.that'sanextremeexample—everyonelovestohateoniceberglettuce—butbenefitcomparisonscouldbemadeforallgreens,withsomeofferingabountyofvitaminsandothersmoremineral-rich. whichgreenspackthemostbenefits? whilesomemayargueforonegreentotopthelist,we'renotgoingtodothat.why?becauseifyoufocusedentirelyonasinglegreen,you'dmissoutonthebenefitsothergreensmayoffer.instead,hereare7differentgreensthateachtopthechartsfortheirownreasons.adietthatregularlyincorporateseachofthesewouldbenefitfromtheuniquebalanceofnutrientprofiles.1.barleygrass barleygrasscomesfromyoungbarleyplants—beforetheyproduceseedsandwhenthey'reextremelyrichinenzymes,vitamins,andminerals.thejuicedpowderfrombarleygrassiswellresearched,andproventoprovidestrongantioxidantproperties.barleygrassisarichsourceoffiber,vitaminsa,c,andk,andpowerfulpolyphenolsandflavonoids.thebenefits:mayhelptoaidsleep,lowerbloodpressure,improvedigestion,reduceanxiety,andsupportastrongerimmunity.*howtogetit:barleygrasscanbefoundinpowderform,butbarleygrassjuice(injuiceformordehydrated)canbe10-20timesmorepotent. 2.spinach ofthegreensselectedforthislist,spinachisonethatyoumayberegularlyconsumingalready.similartobarleygrass(you'llnoticeapattern,here),spinachisrichisvitaminsa,c,andk.butit'salsoastrongsourceofbandevitamins.spinachisagreatsourceofbothiron,calcium,andmagnesiumaswell.thebenefits:maysupporteyehealth,aiddigestion,andlowercholesterol.*howtogetit:spinachisaperfectadditiontoasmoothie,salad,stir-fry,orpasta. 3.kale similartospinach,kaleisacommonsuperfoodgreenfrequentlyusedbothraworcooked.kaleisacruciferousvegetable,'srichinvitaminc,selenium,vitamine,andcalcium.thebenefits:mayhelpsupportbonehealth,immunity,andeyehealth.*howtogetit:whileitcontainsastrongertasteandtexturethanspinach,kale''sagreatadditiontocookedfoods,aswellasjuicedorblendedrawintoasmoothie. 4.chlorellapowder afreshwateralgae,'srichinaminoacidsandmicronutrients,andinclinicaltrialshasdemonstratedheavymetaldetoxificationproperties.thebenefits:mayhelptoaidheavymetaldetoxification,supportimmunity,andlevelbloodpressure.*howtogetit:unlikemostofthegreensyouregularlyhearabout,theonlywaytoincludechlorellaisinpowderform. 5.moringa anativetreetonorthernindia,'srichinantioxidants,iron,magnesium,andvitaminsa,c,ande.thebenefits:mayhelpdefendagainstfreeradicals,andsupportmood,brain,andfoundationalhealth.*howtogetit:whilewholemoringaleavesareedible,they'redifficulttofind(atleastintheus).morecommonismoringapowder,whichcanbemixedintosmoothiesorotherdrinks. 6.arugula alsoacruciferousvegetablelikekale,arugulaisknownforitspepperytasteandabundanceofcalcium,potassium,folate,andofcourseyoura,k,andcvitamins.thebenefits:maysupportnormalbloodandnervefunction,immunedefenses,anddnahealth.*howtogetit:foundinjustaboutanygrocerystore,thepepperyflavorofarugulamakesforagreatadditiontosalads,sandwiches,andpastas. 7.broccolisprouts rawbroccolisproutscontainhighamountsofglucoraphanin,thenutrientthatbecomessulforaphane.andwhenitcomestohealthyplantcompounds,sulforaphanesetsthebarwithincredibleantioxidantandantimicrobialproperties.thebenefits:mayhelpimprovedigestion,supporthearthealth,provideantidiabeticeffects,andpromotebrainhealth.howtogetit:ifyoucanfindthem,broccolisproutsareagreattoppingonasaladorboosttoasmoothie. increaseyourgreensandincreasethebenefits. plant-basedmedicaldoctor,dr.michaelgreger,recommendsatleast12servingsofgreensperweek.butaccordingtohisresearch,only1in25peoplegetthatmanyservingspermonth...thismeansnearlyallofuscanstandtosignificantlyincreaseourgreensintake.makeahabitofaddinggreenstoyourmealswheneverpossible,whetherthat'sasoup,sauce,smoothie,salad,orside.andifyou'reabletoregularlymixinthe7greensabove,you'llhelproundoutthebenefitsforbothshort-andlong-termhealth.superfoodgreensmadeeasy.needaneasierwaytoincreaseyoursuperfoodgreens?trydailygreens.thedailygreensformulafocusesonfivesuperfoodgreens—barleygrass,spinach,chlorella,broccolisprouts,andmoringa—tozeroesinontheingredientsthathavethebiggestimpact.sowhetheryou'rekickingyourdayoffwithasurgeofnutrientsorusingitasanafternoonslump-buster,thediversevitamins,minerals,andcompoundsindailygreenscanhelpsupportyourenergyoptimization,brainclarity,bloodhealth,bonedevelopment,andsomuchmore.madewith5organicsuperfoodgreens,dailygreensprovidesasimplewaytoboostyourdailygreensintake.shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

7 Superfood Greens You Should be Eating (But Probably Aren't)

+Read article

Easy White Bean, Greens, and Protein Dip

Easy White Bean, Greens, and Protein Dip

+Read article

Packaging with a Purpose
packagingwithapurpose(andessential'snewpouch).by:complementformostofus,thebiggestconsiderationwhenmakingapurchaseisquality.howandwhereistheproductmade?whatmaterialsoringredientsareused?willitserveitsintendedpurpose?butforthecomplementteam—sendingoutthousandsoforderseachmonth—whatourproductsarepackagedinhasbecomejustasmuchapartoftheconversation.minimizingplastichasalwaysbeenagiven...althoughit'sthecheapestmaterialandstandardinthesupplementindustry,plasticsandmicroplasticsarefillingourlandfillsandoceans,andcausingallkindsoflong-termenvironmentalissues.sowhataboutglass?whileglasscanbesignificantlymoresustainablethanplasticandagreatoptionforourliquidnutrients(especiallytherecyclableglasswe'veusedforthepastfewyears),it'sheavy.andheavymeansexpendingmoreemissionswhenshippingfromoneplacetoanother—somethingweoffsetthroughreforestationefforts,butit'salwaysbettertoreduceemissionswhenpossible.sowesatdowntotroubleshootawaytobothremoveplasticentirelyfrommostofourproductsandreducetheenvironmentalimpactofshipping.andwehavesomebignews:startingnow,complementessentialcapsules(alongwithcomplementprotein)willbepackagedin100%compostableandbiodegradablepouches.oh,andwe'recontinuingtoplantjustasmanytreestomakeupforwhereothercompaniesfailtoact.(we'renowwellover2,300treesplanted,andcounting.)100%compostable?here'showitworks. ourbiodegradablepoucheswillcompletelybreakdowninanat-homeorindustrialcompost,withfoodscrapsinthetrash,orsimplyburiedinthebackyard.noneedtorecycle.noplasticsmakingtheirwaytotheoceans.thisisahugewinfortheenvironmentandabigstepforwardforourgoalofbecomingthemostsustainablenutrientcompanyonearth.the8hard-to-getnutrients,allinoneplace.asinglecapsulethatprovides8essentialnutrientsformulatedtoimproveenergylevels,hearthealth,brainfunction,andoptimizelongevity.*shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Packaging with a Purpose

+Read article

How Many Servings of Greens Do You Need (And How to Get Them)
areyougettingenoughgreens?(andhowtogetmore)by:mattfrazier,co-founderi’membarrassed,buti'lladmitit:idon’teatnearlyenoughgreens.doyou?onceourcalorieneedsaremet,greensareprobablythesinglemostimportanttypeoffoodinourdiets—theonefoodwedon'twanttoleaveoffourplatesforlong.howcanisaygreensarethehealthiestfoodontheplanet?well,whenyoumeasurenutrientspercalorie—thewaytheydowiththeandiscore,aprettygoodmeasureof"healthfulness,"inmyopinion—greensarethewinner,handsdown.enzymes,antioxidants,anti-inflammatorycompounds...allthebestpartsofaplant-baseddiet,theveryelementsthatmakethisdietsogreatforsportsandlongevity,arepackedintogreens.justtheotherdayicameacrossthisnuggetthatmyfriendsimonhill(ofplantprooffame)recentlyshared:andyet…assoonaslifegetsbusy—ori'mtraveling,orjuststressed—thegreensarethefirstfoodtogo.infact,it’snottoouncommonforanentireweektogobyinwhichidon’teatasingle,intentionalservingofgreens.sure,imightgetsomegreenshereandthereindinners,buti’mtalkingaboutabig,legitservingofgreens—likeabowlfullofsaladorafist-sizedportionofcookedspinachorkale.buti'mfarfromtheonlyone. howmanyservingsofgreensareidealforyourlong-termhealth? inhisbookhownottodie,dr.michaelgregerrecommends12servingsofgreensperweek.seemslikealot,butit’snotimpossibletoimagineyourselfeatingaservingortwoofgreenseverydaytogetupto12perweek.butthenhegoesontociteastudyshowingthatonly1in25americanseatthismanyservingsofgreensinamonth.nowholdon,’snotthatonly1in25(4%),thateliteonepersonoutof25istheonewhoeatstwelveservingsamonth—aquarteroftheamountgregerwantsustoactuallyeat!whyisitsohardtogetourgreens?especiallywhenweknowthey’rethehealthiestfoodsontheplanet?it’snotthatgreensaresohardtoeat.theytastegood(forthemostpart),andit’sprettysimpletothrowtogetherasaladorsautéupasidedishwithdinner.theproblemwithgreensisthatwhilethey’reeasytoeat…they’realsosoeasytonoteat.notawholelotofmeals(certainlynotpre-madeones,butnotevenmostrecipes)includelargeportionsofgreens,thewaytheymightfeatureonionsorbellpeppersorsomething.whichmeansyoucan’’vealsogottoplantogetyourgreens. 4simplewaystoeatmoregreens(andwhythey'reactuallynot-so-simple). 1)smoothies.ifyou'reasmoothiedrinker,throwingahandfulofspinachorkaleintotheblenderisaneasywaytoknockoutaserving(ortwo).theproblem:it'seasytoruinthetaste.togetcomfortablewithgreensinyoursmoothie,tryfollowingaformulaorrecipes.2)dailysalads.arguablythehealthiestsolutionistoeatadailygiantsalad.thereyoucanaddinavarietyofgreens,sprouts,andatonofothergoodveggiesontop.theproblem:itrequiresextraplanningandahabitchange.(thedisciplinetochoosesaladoveramoreexcitinglunch,ortoprepareandeatthesaladbeforeyourhot,deliciousdinner.)whatworksbestformeistoactuallyeatmysaladwhilecookingdinner.thenit'snotcompetingwiththedinneritself.that,andaddingadelicioushomemadedressing.3)greens-heavymeals.ofcourse,youcanalsoplanmealsthatincorporategreens.lastnight,afterihadwrittenthefirstdraftofpost,isautéedthegreensfromthebeetsiuseforjuiceeachday,andatethemalongwithsomeintobeansandfarro(withlotsofsmokedpaprikaandgarlic).theproblem:findingrecipesthatfeaturealotofgreenscanbedifficult,asthey'renotusuallythestar.soonceyoufindoneofthoserecipes,bookmarkit.4)greenspowders.agreenspowderormixcanbeaneasywaytointroducemoregreenswhentraveling,onthego,orattheoffice.justmixthepowderwithwaterand—theoretically—you'regoodtogo.theproblem:manygreenspowdersdon'tcontainsubstantialenoughquantitiesofeachgreenornutrienttomakearealimpact.ingredientlistswithdozensofgreensandsuperfoodsmaysoundgood,butifthemicrodosesaretoosmall,there'snotmuchpoint.ifyou'reagreenspowderuser,lookforapowderwithscience-backeddosages. thehardestpart?doingthem. allofthesemethodsareeasy...ifyoudothem.butmostofusdon't.atleastnotconsistently.sohere'sachallengeforyou:forthenextweek,keepatallyofhowmanytimesyoueatgreens.areyounearthe12servingsperweekmark?ifnot,startsmallandthinkofhowyoucanaddjustoneservingperday.thentwo.andeventually,you'llentertheupperrealmofgreenseaters,blastingpastthe96%ofpeoplemissingoutontherecommendedamount.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

How Many Servings of Greens Do You Need (And How to Get Them)

+Read article

The Ultimate 15-Minute HIIT Workout
theultimate15-minutehiitbodyweightworkoutforfullbodystrengthby:complementafterturning40,complement'scmomichaelknewhewantedtoimprovehisfitness.onlyinsteadofrelyingonhoursatthegym,hecommittedtoshort,15-minutehigh-intensityworkouts3-4timesperweek.thissimpleworkouthasleadhimtobeinthebestshapeofhislife:theworkout. 7roundsofexercises,eachroundconsistingofa45-secondworkoutanda15-secondrest.afterthe7thround,'smichael'sadvice:theideaistopushashardaspossibleduringthe45secondsthatyou'reworking,'llbesweatingbulletsattheendifyou'repushinghardenough.iusuallypick7differentexercises,butyoucouldalsorepeatafew.herearesomeofmygo-to's:push-upssit-upvariations(orothercore/abexercises)jumpsquats(orotherlower-bodyexercises)handstandagainstthewallbicepcurlswithresistancebandsdown-dogpushupsoranothercoreexerciseburpeesormountainclimbersbutthisisachooseyourownadventurestyleworkout.youcandotheentirethingwithnoequipment(straightbodyweight),orchooseexercisesthatusebandsorkettlebells.allyouneedisatabatatimer,whichyoucandownloadintheappstoreforfree(likethisone).there'snowrongwaytodoitaslongasit'shigh-intensity,safe,andfun.boostyourmusclegrowthandrecovery.madewith5realfoodproteiningredients,complementproteinprovidesacompleteaminoacidprofileoptimizedforplant-basedeaters.shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

The Ultimate 15-Minute HIIT Workout

+Read article

How Much Protein You Really Need and Where to Get It
howmuchproteinyoureallyneed(andwheretogetit)by:complementisyourprotein strategyjust..."ieatabalanceddiet,soishouldbegood?"that'sthecaseformanyplant-basedeaters.wegetsotiredofansweringthedreadedproteinquestionthatmanyofushaveconvincedourselvesthatthere'snowayproteinisamacronutrientofconcern.butinsteadofjustassumingwe'regood(andhopingforthebest),let'stakealookatwhatthesciencesaysaroundproteinrequirementsforvegetariansandplant-basedeaters. howmuchproteindoyouneed? theanswerisn'tstraightforward.formanypeople,itmightbelessthanyouthink,butforcertainpopulations,therecommendeddailyintakecangowayup. here'salookattherecommendations,brokenintoafewsubsets:generalguidance:theu.s.recommendeddailyallowanceis.8gramsofproteinperkilogramofbodyweight(.36gramsperpound).fora140poundwoman,thatwouldcometo50.4gramsofproteinperday.plant-basedathletes:a1995studypublishedintheinternationaljournalofsportnutritionconcludedenduranceathletesbenefitmostfrom1.2to1.4dailygramsperkilogramofbodyweight(.54to.63gramsperpound),whilestrengthathletesdobestwith1.4to1.8gramsperkilogram(.63to.81gramsperpound).fora170poundmalerunner,that'sabout100gramsofproteinperday.age65+:multiplestudieshavefoundthatbecauseolderadultsover65arelessresponsivetoaminoacidsthanyoungeradults,therecommendedproteinintakeincreasestobetween1.2and2.0dailygramsperkilogramofbodyweight—farexceedingthegeneralguidance.thisisfarabovethegeneralguidanceforyoungeradults.fora165poundwomanover65,that'saround90gramsofproteinperday.whyyoushouldn'tignoreaminoacids. knowinghowmuchproteintogetisjustpartoftheequation,asallproteinisnotcreatedequally.proteinconsistsofsomethingcalledaminoacids,someofwhichyourbodycanproduceonitsownandsomeitcan't.thosethatitcan'tarecalled"essential,"andyoumustgetthesethroughfood.thegoodnewsisthatifyou'reeatingavarietyofwholeplantfoods,you'reprobablygettinganicemixofessentialaminoacids.thereareafewessentialaminoacids,however,thataretoughertofindthroughplant-basedfoods—themostnotableofwhichislysine.commonplant-basedstaples,includingtempeh,tofu,andlegumes,docontainlysine.soaslongasyouregularlyconsumebeansandsoy,you'relikelycoveringyourbases. high-proteinplant-basedfoods. wheredoplant-basedeatersgetprotein?fromplants,ofcourse.allplantfoodscontainprotein,'sanexampleof12plant-basedproteinsources,startingwithnutsandseeds,thenmovingontovegetables,grains,andbeans.foodservingsizeprotein(g)caloriesfromproteinflaxseed1oz3.814%chiaseed1oz4.714%almonds1oz614%spinach,cooked1cup549%peas1cup827%seitan1/2cup31.570%oats,cooked1/2cup5.514%quinoa,cooked1/2cup414%tempeh1/2cup15.539%brownlentils1/2cup931%blackbeans1/2cup7.526%tofu1/2cup626%foramorecompletelistofplant-basedproteinsources,downloadthefreeproteingrocerylist,here.  shouldyoutakeaproteinpowder? whilewholefoodsareagreatsourceofprotein,therearemanyreasonswhyyoumaywishtouseaproteinpowderattimes:...tohelpfeelfuller,longer,andevenreducelate-nightcravings.*[findstudieshereandhere.]...tomoreeasilyfulfilldesiredmacronutrientneeds,whetherthat'sbecauseyou'reanathlete,older,orlimitedinwhatyoucancookorpreparethatday....tohelpbuildandgrowleanmusclemass.*...toensureyou'regettingaboostofeachoftheessentialaminoacidswhenyou'reunabletoconsistentlyeatadiversediet.orsimplyforpeaceofmind—toknowyoucaneasilygetahealthydoseofplantproteinwithacompleteaminoacidprofile. whattolookforinagoodproteinpowder. proteinpowders—evenplant-basedproteinpowders—arenolongerhardtocomeby.youcanpickthemupatthegrocerystoreorthroughcountlesscompaniesonline.buttheproteinpowderindustryisfraughtwithtransparencyandingredientissues.hereareafewguidelinestolookforwhenitcomestoproteinpowder:avoidproprietaryblends.manypowderspromotea"blendofpea,rice,andhemp"(forexample)toappeardiverseintheiraminoacids.butifthey'renottellingyouhowmuchofeachingredientisincludedintheblend,itcouldbecomprisedof95%ormoreasingleingredient—typicallythecheapestingredient.avoidfillersandsweeteners.whilethebaseproteiningredientsinapowdermaysoundgreat,thestandardpracticeistoloadapowderupwith"natural"flavorsandsweetenerstogetyouhooked,andfillersofcheapingredientstoreduceproductioncosts.whilea"vanillaicecream"proteinpowdermightsoundgoodonthepackage,chancesareit'sloadedwithjunkyoudon'tneedorwanttoconsumeonaregularbasis.lookforheavymetalandtoxintesting.heavymetalsandtoxins—likelead,arsenic,bpa,andcadmium—arecommoninmanyplant-basedproteiningredients,andthere'snowayofknowingtheheavymetalandtoxincontentsofapowderunlesstheyaretested(withthetestingpublishedpublically)orcontaina"proposition65compliant"badgeonthelabel. whycomplementproteinistheworld'scleanestprotein. complementproteinpowderisaleaderwhenitcomestoclean,transparent,completeplant-basedprotein.whychoosecomplementprotein?it'ssimple:1)theingredients.madeofjustfiveorganicproteiningredients—almond(12%),chiaseed(6%),pumpkinseed(14%),sunflowerseed(11%),andyellowpea(57%)—complementproteinisformulatedtocreateacompleteaminoacidprofileperfectforplant-basedeaters.2)nosweeteners.commonproteinpowdersweetenerslikeacesulfamepotassium,sucralose,splenda,andevenmonkfruitareunnecessaryatbest(andpotentiallyharmfulatworst).complementprotein'sno-sweetenerapproachletsyousweetenyourproteinwithyourfavoriterealfoods.3)it'sflavorless.ourflavorlessformulameansyoucanmix,bake,orblendcomplementproteinintojustaboutanything,likepancakes,smoothies,brownies,'sacleanboostofproteinforanydish.4)transparenttesting.eachbatchofcomplementproteinistriple-testedforpurityandpotency:oncewheneachindividualingredientarrives.againduringproduction.andfinallybyathirdparty,whichtestsforheavymetals,toxins,andotherjunkyoudon'twantinyourpowder.thosethird-partytestresultsarethenpublishedoncomplement'swebsiteforeveryonetosee.save15%whenyouordertoday.shopnowensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

How Much Protein You Really Need and Where to Get It

+Read article

3 Painless Ways to Start Eating Right When Nothing Else Will Work
3painlesswaystostarteatingrightwhennothingelsewillworkby:mattfrazier,co-founderyouknowwhatyou’resupposedtoeat.wholefoods,greens,variety...youdon'tneedanotherwebsitetellingyouthebasics. andit’snotthatyoudon’twanttoeathealthily—youknowhowimportantitis.notjustforyou,butforyourfamily.andthatifyoudon’tstartsoon,it’llonedaybeurgent,ormaybe,toolate.andyet…youcan’’sjusttoomuch,withthetimeitwouldtaketoplanmealsandshopfornewingredientsbeforeyouevengetdowntocooking.nottomentiontheeffortofpackinghealthylunchesforyourselfandyourkids,ifyou’vegotthem.anddon’tevengetstartedonbreakfast…where’sthetimeforthatgoingtocomefrom? themostcommonproblem,straightfromthemouthsofourcommunity. over12+yearsofgrowingthenomeatathleteandcomplementcommunities,i'vespokentothousandsofpeopleaboutwhat’skeepingthemfrombeingwheretheywanttobewiththeirhealthandfitness(andthatoftheirfamily).farandaway,theproblemof“ican’tseemtogetstarted”hasbeenthesinglemostcommonfrustration. thehiddenforcethatpreventsyoufromstarting here’showitgoes,mostoften:"we’vetriedeatingwellinmyhouse,anditjustdoesn’twork.welastfortwodays,andsoonwe’rerightbackwherewestarted.iworkafull-timejobandsodoesmyspouse,andwiththekidsandtheirschoolandeverythingelse,wejustdon’thavethetimetomakeahealthydietwork."tothis,isay…ofcourse.ofcourseit’shardtochangehabits,that'swhymostofusfailatthemthemajorityofthetime.habitsstartoutastinythreads,andeachtimeyourepeatthehabit,youaddanewthread.eventually,you’vegotnotathreadbutacable,andit’sveryhardtobreak.sowhenyoutrytochangenotjustyourownhabitsbutyourwholefamily’sallatonce,you’retryingtobreakfourorfivethickcables.andnotonlyareyouchangingtheexperienceofeating(saytoonethat’slesssalty,fatty,sugary,andenjoyable,atleastatfirst)—you’realsoaddingtoyourschedulesincenewfoodstakemoretimetoplanandpreparethanwhatyou’reusedto.doesthismeanyou’restuck?thatyou’redoomedtoalifeofjunkfoodandthefat,unhealthyfamilythatgoeswithit?no.itjustmeansinsteadoftryingtochangeeverythingatonce,youmightbebetterservedbybreakingthecablesonethreadatatime.thispostisaboutwhichthreadtostartwith.3simplewaystostartsmall ifyou’retalkingaboutahabitlikerunning,it’seasytostartsmall.justgorunforfiveminutes.ortwominutes.thendothesamethingthenextday,andthenextday,andthenext,beforeyoueventhinkaboutincreasingthetime.whateverittakes,setuptherulessoyoustartaccumulatingwins,andyoustarttochangeyourperceptionofwhatitmeansandhowitfeelstorun.butwithdiet,it’snotsoclear.youcan'tjustwaithealthyforfiveminutesaday...changingyourdiettakesadifferentapproach.soherearethreeapproachesthatdoworkforeating—approachesthatallowyoutostartsmall,andeventually,realizebiggains.(thegoodkindofgains,notpounds.) small-stepapproach#1.insteadoftryingtooverhaulyourentirediet,pickjustonedayaweek. andonthatonedayaweek,doeverythinginyourpowertoeatexceedinglywell.isuggestmondays,sothatyoucanusetheweekendstoplanmealsandshop.ontuesday,gobacktoeatinghoweveryouwant,butonmonday,promiseyourself(andwhoeverelsewillholdyouaccountable)thatyouwon’tslipup.onceyoulearnhowtoprepareandexecuteforjustoneday(andgetusedtoit,forafewweeks),it’llbeeasiertodoitformultipledays.afteraweekortwoofhealthymondays,addahealthythursday.andsoon.tosavetimeandeffort,justincreasethequantitiesofwhateveryou’reshoppingforandpreparingontheweekend. small-stepapproach#2.makejustonemealhealthyeachday. tocreatemorecontinuityinyourhealthyhabitsthanjustonceaweek,tryeatingbettereveryday,butjustforonemeal.forexample,replacejunk-foodbreakfastwithasmoothie(easytoadjustfordifferenttastes).ifthatdoesn’tfillyouup,addsomethinglikewholewheattoastwithnutbutter.overtime,youcanfocusonmakingyoursmoothiegreener(justincreasetheproportionofvegetablestofruits),oryoucanfocusonexpandingthenumberofhoursaroundbreakfastthatyoueathealthily.eventually,you’llapproach“veganbefore6”(or“healthybefore6,”ifaplant-baseddietisn’tyourgoal),andyoucanspendafewweekstherebeforegoingalltheway.small-stepapproach#3.goall-in,butgiveyourselfanenddate. iunderstandthatsomepeoplejustdon’thavethepatienceforgradualchange.i’vebeenthere—whenyou’reinspiredtomakeachange,,andcompletely.but“all-in”takeswillpower.forexample,ifyou’reattemptingtogovegetarianorplant-based,whenthatlittlevoiceinyourheadremindsyouthatyoucanneveragaineatarealcheeseburger.tocounteractthis,andmake“all-in”aviableapproach,putatimelimitonyourchallenge—adateinthefuture,where,ifyougettherewithoutscrewingup,youwin.youcanreassessthen,butuntilthetimeisup,you’regoingtomakethiswork.setupafunchallengeforyourselfandthefamily,anddecidethat—forthreedaysoraweekor10days—you’reallgoingtoeathealthily.butdon’tstarttoday—setastartdateafewdaysfromnow(again,mondayisprobablybest)sothatyouhavetimetoprepare.havingadelayedstartdatealsohelpstoincreasetheimportanceyougivethechangeinyourmind,whichmakesyoumorelikelytostickwithitwhencheeseburger-voicestartstalking.havearewardplanned(ideallynotfood)forwhenyoufinish:that,andtheveryfactthatthere’sanenddateatall,willalsohelpyoutokeepgoingwhenyou’recravingjunkfood.onceyou’redone,thinkaboutwhatworkedandwhatdidn’t.plananotherchallenge,modifyingbasedonwhatyou’velearned,andsetitforalongerduration.rinseandrepeat. tohelpyougetstarted twostrategiesthatwillhelpwithanyoftheaboveapproaches: 1.make“healthy”morefun. abigpartoftheresistancetoeatingwellisthathealthyfoodisperceivedasboringandbland.forexample,ifyou’retakingapproach#3,chooseathemethat’sinteresting.makeitaweekofethnicdinnersthatyou’venevercookedbefore—mexicanonenight,thaithenext,indiananother,etc.ortryaraw-foodchallenge.orreplaceonemealaday(yourworstone)withasmoothie.orbuyanewcookbook.makethewholethingaboutsomethingmoreexcitingthan“healthy,”andit’smuchmorelikelytobemetwithopenness. 2.startwhereyouare. igotthistipfrommyco-authorofthenomeatathletebookandregistereddietitianmattruscigno.theideahereistonotradicallyalteryourmeals,butmakesmallchangesineachofthemtomoveitalongthespectrumtowardhealthy.hisexampleisbeefandbroccoli:ifyourgoalistogovegetarianorevenjusteatmorevegetables,stilleatthebeefandbroccoli,butmakeitmoreaboutthebroccoli.overtime,increasetheproportionofbroccoliuntilit’s“broccoliwithatinybitofbeef,”andgoallthewaywhenyou’reready.youcandothesamegradualreplacementprocesswithfruitsmoothies(usingmorevegetables,lessfruitovertime),kids’drinks(slowlydilutefruitjuicewithwater),whole-grainflourorrice,waterinsteadofoilforsauteing,etc.somethingthathasworkedforme,touselesssalt,iskeepingagrinderfulloftoastedsesameseedsandafewcoarsegrainsofsalt,insteadofallsalt.thepointisnottomaketheshiftallatonce,butinsmall,nearlyimperceptiblebitsatatime.noticethattheselasttwotipsaren’tmeanttobeusedalone,formostpeople.ifyou’realreadyeatinghealthily,theymighthelpyougofurther.butwithoutthe“hardline”ofthefirstthreeapproaches,it’stooeasilytograduallyslipbackintobadhabits. yourturn ifyou’reseriousabouteatinghealthilybutjustcan’tseemtostart,theni’mbeggingyou:don’tjustreadthis.pickoneofthethreeapproachesabove.commit.plan.andthengiveitatry.whenyoumessup(andtrustme,youwill),learnandtryagain.lastingchangestartswiththesmallestofsteps,butitdoesn’tstartbystandingstill.someone’sgottoactuallytakethatstep,andthatsomeoneisyou.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

3 Painless Ways to Start Eating Right When Nothing Else Will Work

+Read article

Matcha Date Overnight Oat Plant-Based Recipe
plant-basedrecipe:jules'matchadateovernightoatsby:complementthere'slittlemoresatisfyingthanenteringthekitchenwithyourfoodalreadyprepped.especiallywiththatfoodishealthy,simple,anddelicious.ifyouhaven'tpreppedovernightoatsbefore,itcouldn'tbemoresimple:soakrawoatsinplantmilkovernight(orforatleastafewhours),andyou'llwakeuptosoft,creamyoatmealwithoutanycooking.addwhateveringredientsyou'recraving—likecomplementprotein—duringthesoakingorthenextmorningforadditionalflavor,nutrients,andenjoyment.belowyoucanfindanincredibleovernightoatsrecipebyolympianandregisteredholisticnutritionist,juliamurray.itfeaturesnearendlessflexibilitysoyouneverhavetoworryabouthavingalloftheingredientsonhand.checkoutthefullrecipe,here:ingredients:3/4cuprolledoats(usegluten-freeifneeded)1/4cuprawbuckwheatgroats1/4cupmedjooldates,chopped(subwithraisins)1servingofcomplementprotein1tspcoconutsugar1tspmatchapowder1cupplantmilkofchoice1ripebanana,mashed(optional)otheraddinideas:2tbspof...gojiberrieschiaseedshempseedscacaonibschoppednutsofchoicepumpkinpureeshreddedcarrotsshreddedcoconuttoppingoptions:maplesyrupberriesoranyotherfruitcoconutflakescoconut(oralmond/soy/cashew)yogurtnutbutterchoppedpecans/walnuts/brazilnutsinstructionsaddallmainingredientstoamasonjaroryourfavetupperware.letsoakovernight,orforjust45minutes.inthemorning,serveitupwithyourfavoritetoppings!ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Matcha Date Overnight Oat Plant-Based Recipe

+Read article

9 Life-Changing Interviews with Powerful Plant-Based Women
9life-changinginterviewswithpowerfulplant-basedwomenby:complementaswecelebratewomen'shistorymonthandthisweek'sinternationalwomen'sday,wewanttoshareninepowerfulinterviewsfromfemaleregistereddietitians,cookbookauthors,yogatherapists,andentrepreneurswhohavededicatedtheirlifetohealth,happiness,andhelpingpeoplethriveonaplant-baseddiet.theinterviewswereoriginallysharedonnomeatathleteradio,theaward-winningpodcastfromoursistersite,nomeatathlete.withover400episodespublished,therearecountlessinterviewswithwomenattheforefrontofpositivechange.buttoday,wesharetheninemostpopular,coveringtopicslikewholefoodcooking,weightloss,intermittentfasting,yoga,andthefutureofplant-basedeating. 1.intermittentfasting101withdr.pamelafergusson,rd interestedinintermittentfastingbutdon'tknowwheretostart?inthisinterview,dr.pamelafergusson,rd,walksyouthrougheverythingyouneedtoknowtogetstartedwithintermittentfasting,thesciencebehindwhyitcouldbebeneficialforyourhealth,andhowtoensurethatyou'redoingitinawaythat'shealthyforyourbodyandlifestyle.listenhere: 2.highcarbhannahonastarch-baseddietandhowshelost70pounds hannahhowlett,betterknownashighcarbhannahonyoutubeandsocialmedia,,she'sspreadingthevalueofaplant-baseddiettomorethan1,000,000followers.inthisepisode,hannahandherhusbandderekdiscussweightloss,theveganyoutubescene,andwhyfruitarianismdidn'tworkforthem.listenhere: 3.thehealingpowerofyoga(andhowyoucangetstarted)withkatiehay it'snosecretthatyoga'spopularityhasboomedoverthepastseveralyears.butformany,it'sstilltoointimidatingtoactuallytry.inthisepisode,katiehay,yogatherapistc-iayt,shareshowyogacantransformyourlifeandhowtogetstarted.sheanswersmanyofthequestionspeoplehavebeforetheirfirstclass,andhowyogacanplayaroleinlong-termhealthandshort-termperformance.listenhere: 4.addiction,weightloss,andretrainingyourbrainwithsusanpeircethompsonofbrightlineeating whatrolecanaplant-baseddietplayintransformingyourlife?there'stheweightlossandthelong-termhealthbenefits,butwhataboutamentaltransformation?inthisepisode,susanpeircethompsonsharesherstoryofaddiction,food,andthepowerofeatingplants.listenhere: 5.theplant-baseddietforbeginnerswithpamelafergusson,rd,phd iftherewasaclearblueprintforeatingaplant-baseddiet,whatwoulditlooklike?itwouldstartwithansweringthefaqsaroundprotein,meals,andthescience-basedbenefits,thendiveintoactionabletipstoensureyou'regettingeverythingyouneed.inthisepisode,dr.pamelafergusson,rd,walksthroughherplant-basedblueprintforbeginners,tohelpyouthrive.listenhere: 6.howmiyokoschinnerbroughtartisanalcuisinetoveganism thesedays,miyokoschinner'splant-basedcheeseproductscanbefoundinjustaboutanygrocerystoreinamerica.butofcourse,ithasn'talwaysbeenthatway.miyoko'sjourneystartedoutofadesiretobringcolor,craft,andcreativitytothebland,uninspiredvegancookingofthetime.inthisinterview,miyokoshareshercaptivatingstories,importantlifelessons,andgrandvisionforthefutureoftheplant-baseddiet.listenhere: 7.becomingafriendlyveganwithmichellecehnandtoniokamoto michellecehnandtoniokamotohaveadifferentvisionfortheplant-basedmovement—onethatisinclusive,informed,andapproachable.theycallthisthe"friendlyvegan"approach,anditstartswithbeingfriendlytoyourself.inthisepisode,michelleandtonisharetheroleaplant-baseddietplaysintheirlife,andhowthey'regrowingthemovementthroughtheirbook,thefriendlyvegancookbook.listenhere: 8.dreenaburtonand25yearsofplant-basedcooking 25yearsago,plant-basedeatinglookedalotdifferent.therewerenomeatorcheesealternativesinthewaywefindthemtoday,orsupplementsspecificallydesignedforplant-basedeaters.sohowhave25yearsofplant-basedcookingchangedfordreenaburton,andwhatdidshelearnearlyonthatstillinformshercookingtoday?inthisepisode,cookbookauthordreenaburtonshareshowsheapproachesnewrecipesandwhyshefocusesonwholefoodsinhercooking.listenhere: 9.howplantifulkikifoundweightlosssuccesswithahigh-carb,plant-baseddiet foryears,thepopularconsensuswasthatyoucouldn'tloseweightonahighcarbohydratediet.butafterstrugglingtofindatraditionalweightlossprogramthatworkedforher,plantifulkikitriedsomethingcompletelydifferent...anditworked!inthisepisode,kikishareshowherfamilyisthrivingwithahigh-carb,plant-baseddiet,andwhyshebelievesthistransformationledtolong-termsuccess.listenhere:ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

9 Life-Changing Interviews with Powerful Plant-Based Women

+Read article

5-Minute Protein Hummus
plant-basedrecipe:5-minuteproteinhummusby:complementthesedays,hummusisusedforeverythingfromdipstosaladdressings.buthaveyouevermadeitathome?todayweshareoneofthesimplesthummusrecipesyou'llfind,perfecttouseas-is,ortospiceupwithwhateverflavorsyou'recraving.allyouneedisahandfulofingredientsandafoodprocessororhigh-speedblendertogetcreamy,delicious,protein-richhummusthatwillrivalanystore-boughtoptionatthemarket.(bonus:makethisrecipeoil-freebysimplyexcludingtheoliveoil!) aboostfromcomplementprotein?chickpeas—thestaringredientinhummus—arerichinvitamins,minerals,andfiber.butwhenblendedwithsmooth,flavorlesscomplementproteinassuggestedinthisrecipe,togethertheycreateanutrient-richspreadloadedwithhealthymacronutrients.checkoutthefullrecipe,here:ingredients:1(15oz)canofchickpeas(or2cupsofcookedchickpeas),savetheliquid1tbsptahiniand/ormisopaste4clovesofgarlic1lemon,or1/4cuplemonjuice1/4to1/2cupofchickpealiquid1tbspofcomplementprotein1-2tbspofoliveoil(optional)salttotasteoptional:1tspsmokedpaprikaordill directions:throwallingredientsintoyourfoodprocessor.pulseafewtimes,thenletitrun.turningofftoscrapedownthesidesafewtimes.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

5-Minute Protein Hummus

+Read article

The Whole You Habit Guide
thewholeyouhabitguideby:complementhere'sthehardtruthaboutsettingahabitinthenewyear:eachyear,areported80%ofnewyear'sresolutionsfailbyfebruary.that'sright...asinspiredasyoumayfeelonjanuary1st,theoddsarestackedagainstyou.butdon'tpanic!—thecorebuildingblockstomakingalastingchange.andtokickoffourwholeyouin2022series,complementco-foundersmatttullmanandmattfraziersitdowntodiscusswhatstrategiesledtotheirmostsignificantlifechanges,andthelessonsthey'velearnedfromfailedhabits.thiswholeyouhabitguideisaconcise25-minutevideoaddressingexactlyhowtoestablishthecriticalhabitsrequiredformakinglastingchanges.watchit,here:inthevideoguide,theycover:takingsmallactionsvs.goingallin:howtofindtherightapproachforyourgoals.the'twodayrule'tokeepyouontrackwhenthingsgettough.doyoubelieveinyourself?here'swhyyoushould.theessentialselfagreementtomakewhenoutliningyourplan.thepowerofachallengetomakeyourgoalfeellessoverwhelming.rewardingyoursuccesses.clickheretowatchthewholeyouhabitguide...itmightjustbethebestthingyoudoforyouhabitsallyear.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

The Whole You Habit Guide

+Read article

Vegan Banana Pumpkin Protein Waffle Recipe
plant-basedrecipe:bananapumpkinproteinwafflesby:complementhottake:pumpkindoesn'talwaysmakefalldishesbetter.butsometimes—whencombinedwithjusttherightingredientsandspices—pumpkinwillturnarecipefromgood...toabsolutemagic.thisbanana,pumpkin,''sversatile(worksaswafflesorpancakes).it'sloadedwithcleanplant-basedprotein.andeachsavorybitetransportsyoutothecozinessofawarmingfireonacrispfallmorning.checkouttherecipebelow:veganbananaoatpumpkinwaffles(orpancakes!) makes:5-6waffles(note:battercanalsobeusedforpancakes!)ingredients:3cupsoats(blendtoaflourfirst)2bananas3/4cuppumpkinpurée1tbspofcinnamon1/4tspbakingsoda1/2tspbakingpowderpinchofsalt1/4cupcomplementproteinoatmilktoblend directions:blendoatstoaflour.addallotheringredientsandmix.heatupyournonstickwafflemaker.add1/2cupforeachwaffle.topwithmaplesyrupandfruit! ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Vegan Banana Pumpkin Protein Waffle Recipe

+Read article

Plant-Based Travel on a Budget
plant-basedtravelonabudgetwithabipenaby:complementspend10minutestalkingtoabipenaandyou'llbesmilingfortherestoftheday.that'sthelevelofjoyshebringstoeverythingshedoes.abiisaplant-basedathlete,foodie,dailycomplementplususer,andempoweredteamambassadorcurrentlybasedoutofnewyorkcity.butmostofall,withherstrongdesiretoexploreandunmatchedabilitytojumponanyopportunitythatcomesherway,she'saworldtraveler.andsheproudlydoesitonabudget.duringarecentconversation,iaskedabitoshareherbesttipsfortravelingonabudget,whichallowhertoexperiencenewfoods,cultures,andlifestylessofrequently.hereareher3bigtipsforplant-basedtravelers: iscrapetheinternetforflights.notjustoneflightsearchtool,buteverytravelwebsiteicanfindtoseewhoisofferingthebestdeal.andwhenican,ileanonmilesfromcreditcards.butmostimportantly,itrytotravelduringtheoff-season.forexample,i'vefoundthecheapesttimetogotoeuropeisinoctoberandmarch,sothat'swheniplanthosetrips. 2.accommodations accommodationsarewherealotofmoneygetsblown...especiallywhenyouaren'tdoinganythingtherebutsleeping!ifyou'regoingsomewherewhereyouwanttoseesights,meetpeople,orhangoutatthebeachallday,findingaccommodationsthatfityourneedsbutaren'texcessivelyniceisagoodwaytoreducethebudget.maybethat'sahostel—i'vestayedinsomeroughones—oralessexpensivehotel.thinkofaccommodationsasaplacetosleep, iamafoodie.ahugefoodie.butthatdoesn'tmeanineedtoeatatamichelinstarrestauranteveryday.formostofthedaywheni'mtraveling,igoverycheapwithveganstaples—abanana,plantbitesorplantproteinbites,andasnackfromacoffeeshop.ifihaveablender,iusecomplementprotein,whichilovebecauseit'sflavorlessandicanusewhateverfreshfruitihaveonhand.plusthataddedproteinhelpswheni'mrunningaroundallday.thenatdinner,igoforsomethingmoreexciting...onlyinsteadofleaningonthetouristyrestaurantswhichareoftenoverpriced,imakeapointtogettoknowthelocalneighborsandseewhichrestaurantstheyrecommend.usually,it'ssomewherenotinaguidebookandturnsouttobemoreauthenticandcheaper.  mymostimportanttraveltip? beopentowhatevercomesyourway.meetpeople,havefun,andseewherethetriptakesyou.that'swheretherealmagichappens.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Plant-Based Travel on a Budget

+Read article

Plant-Based Recipe: No-Bake Apple Pie Energy Balls
plant-basedrecipe:no-bakeapplepieenergyballsby:matttullman,co-founderwhenitcomestoahomemadesnack,ihavethreerules:itmustbeeasytomake.itmusttastegreat.itmustbehealthyandempowermylifestyle.becausewhenyouhaveaneasy,healthysnackoptionavailable,you''sanenergyballrecipefromesther,oneofcomplement'scustomerexperienceexperts,whichfitsallofmycriteriaandmore.they'reno-bake,simple,andloadedwithproteinforon-the-gonutrition.checkouttherecipe,here:yields:12ballspreptime:15minutesdifficulty:easy ingredients5largemedjooldate,pitted1/2ccomplementprotein1/2cunsweetenedapplesauce1tspcinnamon1tspmaplesyrup(omitifusingsweetenedapplesauce)1/2tspvanillaextract1/2cwalnutsdirectionsblendinafoodprocessoruntilfinelyground.scooppalm-sized/golf-ball-sizedhandfuls,rollintoaballandfreeze.topwithcashewfrosting,ifdesired.complementplus+learnmorecomplementcore+learnmorecomplementessential+learnmorecomplementprotein+learnmorecomplementplantbites+learnmoreensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Plant-Based Recipe: No-Bake Apple Pie Energy Balls

+Read article

Plant-Based Recipe: Easy vegan curry
plant-basedrecipe:simple,ugly,vegancurryby:complementwehaveaprettyfoodproblem.instagram,blogs,newsletters...they'recoveredinplatesofcolorful,vibrantfood,leavingyouwiththeimpressionthatthisistheonlywaytoeatahealthyplant-baseddiet.andsure,"eattherainbow,"isagoodgoaltohave,butlet'sfaceit...mostofusdon'thavetimetocookcolorfuldisheseverynight.andthequickandeasydishes—asimplepasta,slowcookerstews,andevenhealthysmoothies—areoftenasinglecolor(brown-ish).sotodaywe'releaningintothemonotonewithan"ugly"dishthat'ssoeasyandhealthy,itdeservesanimmediatespotinyourregularreciperotation. simple,ugly,vegancurry. whileitmaynotlookliketherainbow,thisquickcurryrecipefromjuliamurrayispackedwithanarrayofhealthy,nutrient-richingredients.itevencallsfora1/4cupofflavorlesscomplementproteintothickenthecurryandaddanextraboostofcompleteprotein.butthebestpart?itonlytakesabout10minutestoprep!checkouttherecipe,here:ingredients:1largesweetoryellowonion,chopped3clovesgarlic,minced6-8whiteorbrownmushrooms,sliced1-2jarsofredorgreencurrypaste(112gramjars)1smallcancoconutmilk(200ml)1veggieboullioncube1/4cupcomplementprotein2medium-largesweetpotatoes,chopped1largeeggplant,chopped1cauliflower,chopped2leavekaleor2handfulsspinach,thinlysliced1-2tbsppeanuts(fortopping)3-4sprigsfreshcilantro(forgarnish) directions:bringpottomediumheat,thenaddonions,mushroomsandgarlic.letsauté,andaddabitofwatertode-glazethebottomofthepot.after5minutes,addthecurrypaste,coconutmilk,bouilloncubeandacupofwater.stiruntilmixedevenly.addthesweetpotatoes,eggplant,andcomplementprotein.addwateruntiltheveggiesarejustcovered.bringtoaboil,andthenturndowntosimmerfor30minutes.addinthecauliflowerandgreens.letsimmeranother5minutes.toserve,laydownsomepre-cookedbrownriceoranyothergrain(ornot),addcurry,andtopwithpeanutsandcilantro!

Plant-Based Recipe: Easy vegan curry

+Read article

Plant-Based Recipe: Chocolate Blueberry Turmeric Protein Smoothie
plant-basedrecipe:chocolateblueberryturmericproteinsmoothieby:complementit'seasytofindyourselfinasmoothierut—blendingthesamefruitsandgreenseveryday.solet'smixthingsup:thissuperfoodbonanzaofasmoothieispackedwithblueberries,greens,bananas,chocolate,andthestaringredient...turmeric.turmericisahealthyfoodeasytoignorebecauseofitspotentflavor.butcurcumin,theactiveingredientinturmeric,haspowerfulanti-inflammatoryeffects,greatforbothyourshort-andlong-termhealth.thissmoothierecipenotonlybalancesouttheturmericflavor,butpacksinotherkeynutrientsfromthefruitandgreens,andaboostofproteinfromcomplementprotein.tapintoyoursmoothiecreativitywiththisnewrecipe:chocolateblueberryturmericproteinsmoothie ingredients:1-2cupsblueberries(orotherberriesofchoice)3cups(ormore)ofpackedgreens(spinach,lettuce,kale,orcollards)tip:whenusingkaleorcollardsripofftheleafyparttouseinthesmoothie,andcompostthe‘spine’)1cmoffreshturmeric,or½tspturmericpowder+apinchofpepperforabsorption2-3frozenornon-frozenbananas1½cupsplantmilk1tbspofcacaoorcocoapowderwater(optional,ifyouwantamoresip-ablesmoothie)1servingofcomplementproteintopping:1tbspcacaonibs(optional) directions:addeverythingexceptthecacaonibstotheblender.startwiththegreens,turmericandpowderonthebottom,thentopitwitheverythingelse.blend!pulseafewtimes,thenslowlyincreasethespeedtomaxandblenduntilsmooth.addwaterifyouwantathinnerconsistency.pourintoyourfavoritejarandtopwithcacaonibs.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Plant-Based Recipe: Chocolate Blueberry Turmeric Protein Smoothie

+Read article

Are plant-based eaters more susceptible to nutrient deficiencies than others?
areplant-basedeatersmoresusceptibletonutrientdeficienciesthanothers?by:complementareplant-basedeatersmoresusceptibletonutrientdeficienciesthanothers?it'soneofthemostcommonquestionswereceive,andtheunderlyingproblemthatleadmattandmatttocreatecomplement—thefirstmultivitaminengineersspecificallyforplant-basedeaters.tohelpusbreakdownthiscommonquestion,weaskedourchiefscienceofficer,dr.joelkahn,md,whatyoucandotoensureyournutritionisoptimizedforshort-andlong-termhealth.watchhisresponsehere:accordingtodr.kahn,yes,plant-basedeatersdoriskcertainnutrientdeficiencies...butsodoeseveryoneelse.everydiethasitsweakspots,andthankfullyforplant-centeredeaters,therearen'tverymany.plantsarethemostnutrient-densefoodsavailable,meaningtherearejustahandfulofhard-to-getvitaminsandmineralstomonitor—likevitaminsb12andd3,dha/epaomega-3s,iodine,andzinc,amongothers.sowhatcanyoudotopreventdeficienciesinyourdiet?dr.kahnsuggestsyoustartbyeatingadietrichinwholefruits,vegetables,nuts,seeds,andlegumes.thenforthenutrientsnotabundantlyfoundinplants,complementyourdietwithamultivitaminengineeredforplant-basedeaters,likecomplementplus.areyoureadytoempoweryourlifestyle?ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Are plant-based eaters more susceptible to nutrient deficiencies than others?

+Read article

Vitamin D and a plant-based diet: Everything you need to know
vitamindandtheplant-baseddiet:whatyoureallyneedtoknowby:dr.joelkahn,mdvitamindissoimportantforhealthybodiesthatitisoftenreferredtonowasapro-hormone—morethanjustavitamin. vitamindismadeintheskininresponsetoultraviolet(uv)raysinsunshineandhasaroleinstrongbones,healthybloodvessels,robustimmunesystems,andoptimalbrainandnervoussystemfunction.butsincemostofusworkinside,thechancetogetprolongedsunexposuretoproducevitamindisinadequate.theavailabilityofinexpensivebloodteststomeasurethelevelofvitamindhasidentifiedmanypeoplewhoarefarbelowacceptablelevelsnotonlyduringthewinterbutyear-round.inmyclinic,iwouldestimatethatover75%ofpersonsnottakingvitaminsupplementsarelowindandsomearerockbottom.ontheotherhand,iamalsostartingtoseesomepatientsthatwereadvisedtotakeextremelyhighdosesofvitamindandtheyarecominginpoisonedbyoverdosing. belowireviewafewquestionsandanswersaboutvitamindthatmighthelpyoumakegooddecisionsforyourhealth,particularlywhensunexposureislimitedbytheseasonoryourlifestyle. 1.canartificiallightsproducevitamind? sunlightcausesourskintoproducevitamindbyemittinguvrays.lighttherapy,whichhasaroleinseasonaldepression,hasuvraysfilteredoutandthereforehasnoroleinproducingvitamind.tanningbedstendtoemituvarayswhileitisuvbraysfromthesunshineiswhatstimulatesvitamindproduction.tanningbedsarenotrecommendedforawintertimeboostofvitamind. 2.howmuchvitaminddoineed? theconventionalanswerisabout800iuadayorless.thisistheusualdoseinmostmultivitamins. theavailabilityofbloodtestinghasshownthatthisdoseisrarelyadequatetoachievebloodlevelsover30ng/mlduetoabsorptionissues. 3.whatfoodscontainvitamind? whilevitamindisfoundinfattyfish,eggs,cheese,andbeefliver,thecholesterolandsaturatedcontentissohighandadverseforhearthealththatidonotrecommendthesesources. mushroomsarehighinvitamind2(1cupofdicedmushroomshasabout400iuofvitamind)andmushroomcapsuleswithabout2,000iuperservinghavebeenshowntoboostbloodlevelsadequately. however,studiescomparingd2tod3generallyshowthatvitamind3ismorebiologicallyactiveandeasiertoconvertinthebodytotheactivevitaminandisthepreferredform.mostnon-dairymilkslikealmondandsoymilkarefortifiedwithabout200iuofvitamindperserving. 4.whatarethe2kindsofvitamind? vitamind2istheformfoundinmushrooms.vitamind3isoftenfoundinanimalsourcessuchaslanolin,althoughvegansourcesfromlichenarenowavailable.vitamind3ismoreactiveandgenerallythepreferredformforsupplementation. 5.arecertaingroupspronetolowvitamindlevels? darker-skinnedpeopleandolderpeopleproducelessvitamindfromsunexposure.personswithboweldiseaselikecrohn’sorceliacdiseaseoftenabsorbfatpoorlyandvitamindisafat-solublevitamin.obeseindividualsmaybindvitamindinfatanditwillnotbeavailableinthebloodfortestingortosupplyvitaltissues. 6.whathappensifmylevelsarelow? extremedeficienciesofvitamindweakenbonesandarecalledrickets.lesserdeficiencieshavebeenlinkedtodiabetes,hypertension,dementia,autoimmunediseases,andmultiplesclerosis.vitamindsupportshealthyimmunesystems,sobeingdeficientcanresultinaweakerimmunesystem. 7.canigettoomuchvitamind? yes,andihaveseenseveralcasesthisyearofpersonstakingover10,000iudailyforlongperiodsoftimeproducingillnessandbloodlevelsover150ng/ml. 8.whenshoulditakeavitamindsupplement?  vitamindisafat-solublevitaminandmaybeabsorbedmorecompletelyiftakenwithmeals.mostmealscontainsomefatsothereisnoneedtoaddfattothediettoboostabsorption.pairingvitamindwithvitamink2canalsohelpwithabsorptionandimproveboneandbloodvesselhealth. vitamindshouldn'tbeignored. atmyclinic,allmypatientsgettheirvitamindlevelchecked,withtheoptimalbloodlevelisaround50-60ng/ml. formostpeople,irecommendaddingatleast2,000iuofvitamind3throughasupplement,andmakingitahabittoeatextramushroomsduringthewinter.  areyoureadytoempoweryourlifestyle?ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

Vitamin D and a plant-based diet: Everything you need to know

+Read article

You are limitless: How removing my self-imposed limitations changed my life
youarelimitless:howremovingmyself-imposedlimitationschangedmylifeby:izzyfischerafewdaysago,ifoundmyselfinaheatedargumentwithmypartner.hehadsuggestedthaticoulddosomethingthatisimplydidnotbelieveicoulddo...“whywouldyouevensuggestthat?it'soutofthequestion...ican’tdothat!”iyelled.herespondedwith,“you’renotevengivingyourselfachance.stoplimitingyourself.”immediately,iknewhewasright. “argueforyourlimitations,andsureenoughthey’reyours.”ican’tbearunnerbecausei’mnotbuiltlikeone.ican’teatbreakfastbecausemycoachdoesn’teatbreakfast.ican’twearthatdressbecausemyshouldersaretoobroad.ican’tbeanathletebecausei’mnotnaturallyathletic.ican’tbeabusinessownerbecausei’mnotoldenough. butlet’srewindabitwithaconversationi’llneverforget:at17yearsold,onapooldeckafterswimpractice,myassistantcoachtaryncameoverandsaid,“izzy,you’resostronginthewaterlately.whyhaven'tiseenthatinyourcompetition?”irespondwithamere:“iguessi’mjustapracticeswimmer.”myfriendswereathletes—phenomenalathletesatthat—andialwaysfelttwostepsbehindthem.theyweredestinedtobeolympians,d1collegeathletes,andeventuallyprofessionalsintheirrespectivesports.buteventhoughicouldkeepupwiththeminpractice,ihadconvincedmyselfiwasapoorracer,andasaresult,racedpoorly.thoseself-imposedlimitsbecamemycorebeliefs.andthosebeliefsinhibitedmefromcomingclosetotheirathleticstature,whichfollowedmethroughmycollegeandearlytriathloncareers.ifonlyiknewthelimitsiwasplacingonmyself. inhindsight,icanseeendlessexamplesofwhereiwasstuntingmyself.iwascontributingtoanoverallpoorself-imagethatworsenedastimewentonandbledfarbeyondswimming,tomycareer,andevenmyhealth.familypressures,societalexpectations,dietculture...itallgotthebestofme.andbythetimeiwasdonewithcollege,iwastired,alone,unhappy,andhidingbehindasevereeatingdisorderthatifleftuntreatedwouldlandmeinareallyscaryplace.toputitbluntly,ihatedmyself,andithoughtthatifonlyicouldlooklikemyteammates,i’dfinallybetheathleteialwayswantedtobe.myeatingdisorderwasamaskforalloftheselfhatethatcamefromcomparingandlimitingmyself.butinhindsight,itwastheeatingdisorder—andtherealizationthatifididn'tgetbetter,itwouldkillme—thatcausedmetodothework.myeatingdisorderrecoverycoachhelpedmefindaworldwhereilookedbeyondthecomparisonsandthelimitsthatiputonmyself.insteadoffocusingonallofthethingsicouldn’tbe,istartedtofocusonthethingsthaticouldbe.istoppedcomparingandistartedprioritizingmyhealth. iamanathlete,andi’mgoingtobeagreatone.ideservetoeat.ineedtoeat.ifuelmybodywiththingsthatmakemefeelgood.iamaleaderandcanbuildbig,importantthings.iaminspiring,iamfantastic,andiambeautiful.icandohardthings. myself-deprecatingandlimitingbeliefsshrunk,andibegantofeel...limitless.sixyearsafteristoodonthepooldeck,doubtingmyselftothecoach,iqualifiedforthe70.3ironmanworldchampionshipsinnice,france,whereicompetedononeofthemostdifficultcoursesintriathlonwiththebestathletesintheworld.ayearafterthat,ilaunchedmyowncompany,plantbites,withamissiontoreinventsportsnutritionwithwholefoods.andicametounderstandthatyes,icandohardthings.butittookmeyearsoflimitingmypotentialtofigurethatout,whichstoppedmefromnotjustreachingmygoals,butsettingthemaltogether.youarelimitless. imagineaworldwhereyoudon'tputlimitsonyourself.aworldwhereyoubecomeeverythingyouknowthatdeepdownyou'recapableof.thatworldisyourreality,ifyouembraceit.ifthere'sonethingi'velearnedthroughmyownexperience,it'sthatachievingsomethinggreatdoesn'tmeanyouhavetobecomesomeoneelse.youdon'thavetolook,dress,sound,orbelikeothers.andwhenyoustopcomparing...whenyoubecomeyourownbiggestfan...everythingstartstoclickandgreatnesshappens.giveyourselfpermissiontodohardthings.giveyourselfpermissiontotry,andfail,andtryagain.giveyourselfpermissiontobelimitless.areyoureadytoempoweryourlifestyle?ensureyou'regettingtheprecisenutrientsneededtothriveonavegandiet...andnothingelse.startcomplementingeverythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).everythingyouneedtoknowaboutsupplementingaplant-baseddiet. gettheultimateguide(it’stotallyfree).

You are limitless: How removing my self-imposed limitations changed my life

+Read article